Brucella ovis ATCC 25840 uid58113

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|148558612|ref|YP_001257161.1| rhodanese family protein [Brucella ovis ATCC 25840]
    MSNLPFTVAALYCFAPLPQYESLREPLAQLCCANGIKGTLLLAAEGINGTVAGSAGAIEKLIAHITAIPGLGEPELKYSH
    ASEMPFHRMKVRLKREIVTMGVEGIDPLKSVGTYIAPKDWNALIADENTVVVDTRNDYEYAIGTFEGAIDPQTRTFREFP
    EWVKQNRDRLEGKKIAMFCTGGIRCEKATAFVKGLGFDDVYHLKGGILKYLEEVPREQSMWNGECFVFDERVAVGHGLAE
    SDVELCRACRRPLTPQDKLSQFFEEGVSCAGCYAERTPEDRARYAERQKQVKLAEKRGANKHIGS

    >gi|148558673|ref|YP_001257345.1| glutaredoxin-like protein nrdH [Brucella ovis ATCC 25840]
    MRECPWCVRKVAWCSMRCFPAAHRCIPIIVQSHILIHFMRKTMNVTVYSKPACVQCTATTRALDRQGIDYKVIDISADAN
    AFDLVQGMGYRQVPVVVAGENHWAGFRPDMISSLA

    >gi|148558009|ref|YP_001257428.1| methionine sulfoxide reductase B [Brucella ovis ATCC 25840]
    MKYQKSAEAIAKLSAEQYRVTQENGTERPGTGEYLYNKEPGIYVDIVSGEPLFASSDKYESHCGWPSFTKPIERANVTEL
    TDMSHGMVRTEVRSAHGDSHLGHVFPDGPVDRGGLRY
    CINSASLRFVPKDRMEAEGYGDYLDQVEG

    >gi|148557870|ref|YP_001257434.1| hypothetical protein BOV_A0397 [Brucella ovis ATCC 25840]
    MMALYMQALLGGMLIGLSAVLLLLLNGRVAGISGIVGRLLDGKQISGNLLFIIGLLMGPVVYAWIFGAFPATDIAASWPV
    ILIAGLLVGVGTRMGSG
    CTSGHGIVGLARFSRRSLVATIVFLIAGVIAASLARAFL

    >gi|148558309|ref|YP_001257493.1| dihydrolipoamide dehydrogenase [Brucella ovis ATCC 25840]
    MSEISCKLLIIGGGPGGYVCGIRAGQLDIDTVLVEKTRLGGTCLNVGCIPSKALIHAADEFHRLTTFAAKSPLGITTQNP
    AIDFARTLEWKDGIVHRLNSGVAGLLKRSRVRMFQGQARFQDGKTVLVDTDTGRQTIHAENIVIATGSVPVEIQALPFGG
    NIISSTEALSLEKIPERLAVVGGGYIGLEIGTAFAKLGSRVTVVEATDRILPQYDAELTRPVMARLKTLGVEVLTGTSAK
    GLSADGKALEIRTQDGAVKAIEADKILVTVGRKPQTDGWGLSEIRLDMDGRFIRIDDRCRTSMRGIYAIGDVTGEPMLAH
    RAMAQGEMVAEIIAGGKHAWDKRCIPAVCFTDPEIVTVGLSPDEARKAGHNIQTGLFPFQANGRAMTMERDDGIVRVVAR
    ADNHVILGIQAVGAGISELSAAFAQAVEMGARLEDIAATIYAHPTLGEGFAEASMKALGHALHV

    >gi|148557851|ref|YP_001257566.1| dsba oxidoreductase [Brucella ovis ATCC 25840]
    MTGKKITIDVVSDVVCPWCFLGRKRLEAALASLPDVEAEIRWRPFQLDPTLPPHGKDRQTYLREKFGTGSKIDDSHRQLR
    ALGEEYGIVFDFDAIIRAPNTLDAHRVIHWAAQAAPDTQDRMVGMLFSLYFEQGQDIGNHEVLVDAAASVSMDAEVVARL
    LQSEADKDTIRDEIATANRIGVRGVPCFIIDQKYAVMGAQTPDVLADAIRQTAEGFEPGIAEDR

    >gi|148558030|ref|YP_001257669.1| alkyl hydroperoxide reductase C [Brucella ovis ATCC 25840]
    MLGIGDKLPSFKVTGVKPGFNHHEENGVSAFEEVTEQSFPGKWKVIFFYPKDFTFVCPTEIAEFARLASEFEDRDAVVLG
    GSTDNEFVKLAWRRDHKDLNKLPIWSFADTNGSLVDGLGVRSPDGVAYRYTFVVDPDNVIQHVYATNLNVGRAPKDTLRV
    LDALQTDELCPCNREVGGETLKAA

    >gi|148558310|ref|YP_001257813.1| organic hydroperoxide resistance protein [Brucella ovis ATCC 25840]
    MPILYTTQSTATGGRTGSAKTADGRLSVVLDTPKELGGQGGEGTNPEQLFASGYSACFLRALKFAAAKEKISIPAESTVT
    ATVGIGPREDGTGFGLDVALSIALPGIDKAKAEELVQAVHIV
    CPYSHATRGNLDVRLSVA

    >gi|148558069|ref|YP_001257817.1| putative ada regulatory protein [Brucella ovis ATCC 25840]
    MLFTLPNQDKLYDALVARDASYEGRAYVGVLSTGIFCRLTCPARKPKPENCRFFASVAECMADGFRPCKRCHSLQPAAEA
    EILVKKLLNALETDPERRWSEEDVVRMGFDPSTVRRSFRRHFGMTFLEMARQERLRHGFQVLAGGGRVIDAQVDAGFESP
    EAFRSAFARIVGLPPAKLRKEGLLRADWFKTPLGTMIAICDVRSLHLLEFADRKALPAELKKLHAACRGDIGIGRFETHD
    LVERQLNAFFEGRSAVFDLPLVMHGSPFTQDVWRELQNIRASETRSYSEIARAIEKPLAVRAVARANGANQIAIVIP
    CHR
    AIGADGALTGYGGGLWRKQKLIEIEAQYRR

    >gi|148558269|ref|YP_001257821.1| thioredoxin [Brucella ovis ATCC 25840]
    MRGIPMTSQDNPYGGAYGGPASQMTANVSFGQPSAPANGGDLIKDTTTAGFQADVITESRKQPVLVDFWAPWCGPCKQLT
    PIIEKAVRKARGAVKLVKMNIDDHPAIAGQLGIQSIPAVIAFVNGQPVDGFMGAQPETKVKEFIAKVGGPSDQEAALAEA
    IATAKELAQAGDFVQAAEIFSSILQVAPDNVDAVVGLATCMLESGDAEQARSLLGTLAAEKQNEAPVRALEARLALADQV
    KLIGDPVELERRLAADPGDYQARFDLAQVRNAQGRRDDAANELLAIMRADRAWNDDGARKQLLQFFEAWGHMDPATLTAR
    RKLSSLLFS

    >gi|148558482|ref|YP_001257916.1| putative glutathione S-transferase [Brucella ovis ATCC 25840]
    MKLYYKAGACSLASHIILEEAGLAYTLEAVDLKAKKTASGADYLAINPRGAVPALEVEPGVVITQNAAILQYIGDHSHVA
    AFKPAYGSLERARLQEALGFCSDLHGAFGGLFAPNLSEEARPGIIANINRRLGQLEAMLADEHSYWLGAEFTQADAYAAV
    ILGWDVGMKLDLNAYPKALRLYERVLARPNVQKAMKEEGLI

    >gi|148558051|ref|YP_001257948.1| hypothetical protein BOV_A0978 [Brucella ovis ATCC 25840]
    MQVYLPNKPRQLRLRLFVFKRLKSMSAHPRISITYCTQCNWLLRAAWMAQELLQTFGQDLAEVALRPGTGGVFEIRVQMP
    DGSEELIWERKRDGGFPEAKVLKQRVRDLVWPERDLGHSDRPISS

    >gi|148558730|ref|YP_001257976.1| methionine sulfoxide reductase A [Brucella ovis ATCC 25840]
    MSFFDSYRKKMQMPSKEEVLPGRVQPIPTAAAHFVSGHPLKGPWPDGMKQVLFGMGCFWGAERLFWQVPGVYVTAVGYAG
    GITPNPTYEETCTGLTGHAEVVLVVYDPKVVTLNELLALFWEEHDPTQGMRQGNDIGTTYRSVIYTFNAVDRAVAEKSRD
    AYSQALASRGLGPVTTQIADAPDFYYAEDYHQQYLAKNPDGYCGLRGTGVSCPIPLAH

    >gi|148558989|ref|YP_001258053.1| molybdopterin biosynthesis protein MoeB [Brucella ovis ATCC 25840]
    MFAGMNASSRPFSPEELERYARHIVLPVIGGPGQQKLKAARVLVVGAGGLGAPVLQYLAAAGVGTLGIVDDDTVSLSNLQ
    RQIIHDTDSIGQPKVESALASIARINPHVKVEGHQLRLDAHNAEALIAGFDVVVDGSDNFATRYVLADAAAKVGRPLVTG
    AMGRFDGTVTVLMPYANGPDGAKNPSYRDLFPDAPPPGTVPS
    CAEAGVLGVLPGVIGSLQAMEVIKLVTGIGEPLVGRLL
    LYNALNVRFETIRYKARKPK

    >gi|148560073|ref|YP_001258139.1| thioredoxin family thiol:disulfide interchange protein [Brucella ovis ATCC 25840]
    MTETTEKPAAQKKRASWVALLPLLIFVGLAAVFAVQLLSGKDNSIIPSVLIGKQAPLTNLPPVEGLMRDGAPVSGFNSED
    LKTGPGGKLTLVNVWGSW
    CVPCRQEHPLLMEIAKDERIRVVGINYKDQPENARRFLGDLGNPFAAVGADRAGRSAIEWGV
    YGVPETFLVDQTGKIVYKHVGPFTPESVKNDLLPAVEKALQQR

    >gi|148559756|ref|YP_001258216.1| methylated-DNA--protein-cysteine methyltransferase [Brucella ovis ATCC 25840]
    MESFGITVFETPIGPCGIAWRGSKIVGVEIGEADEKETRHRLRERFAGGEYAEPPAFIRQTIEKVRALLDGASPDFSDTP
    LALDSVPDLNRRVYEIILELKPGETTTYGAIARRLGDVSLSQAVGYALGKNPFPIIVP
    CHRVLGSNGKVGGFSAAGGTAT
    KLRLLNIERARTTSEPDLFGGLPLQERPQTGW

    >gi|148559523|ref|YP_001258246.1| copper-translocating P-type ATPase [Brucella ovis ATCC 25840]
    MNKTVKPEAVSFPVPVEGMSCASCVSKVEKALSGVPGVTRASVNLATEHAHVELAGRVALSELIKAVEKAGYEAHALDEA
    RSDARAETQSEKRDAEAAELKKSVILAAILTLPVFILEMGSHLIPAVHVFVMDRIGMQNCWYLQFVLTTLVLFGPGLRFF
    KKGVPTLLRGTPDMNSLVVVGTFAAWGFSVVATFLPGALPEGTVNVYFEAAAMIVTLILIGRYLEARAKGCTSAAISRLV
    GLQAKSARVVRDGQAIDVPLEDVRAGDIVQVRPGEKVPVDGEVIEGASYVDESMITGEPVPVAKEKGAAVVGGTINKTGA
    FTFRATKVGHDMVISQIIRMVQDAQADKLPIQAMVDKVTGWFVPAVMAAAAITFVLWLAIGGTAMMGYALVNAIAVVIIA
    CPCAMGLATPTSIMVGTGRAAEFGVLFRRGDALQTLRDASVIAVDKTGTLTEGKPALAHFDTVEGFDKDELLALVAAVEA
    RSEHPIADAIVAAAQEKGLKLAEVSAFEAVPGFGLKASVGGREVAIGADRYMAKLGADVAVFAEDAKRFGDEGQSPLYAA
    VDGRLAAILTVADPMKETTPAAIAALHAQGLKVAMITGDNRRTAQAIARKLGIDEVVAEVLPDGKVAALKRLSAGGKRIA
    FVGDGINDAPALAAADVGLAIGTGTDIAIESADVVLMSGDLRGVVNAIAISKATIRNIGENLFWAFAYNVALIPVAGGIL
    YPFTGTLLSPVLAAGAMALSSIFVLSNALRLRRLRLAVQ

    >gi|148560038|ref|YP_001258399.1| twin-arginine translocation pathway signal sequence domain-containing protein [Brucella ovis ATCC 25840]
    MMNRRQILAATAAGAATFALSGGSGLAQRVPSVAEVLYDKEIPVLGNPNGDVTIVEYFDYQCPYCKKSHADLMRVVRKDG
    NVRLVMKDWIIFGETSAYAARLVLAAEKSGNYEKAMEALMTTPGRLTRDQVDGALKKAGLDAAKLQAAYKADAKRIDGIL
    QRNMKQGEAFNFAGTPSFVIGTRLYGGVMKEKELLEAIKNARKT

    >gi|148559859|ref|YP_001258400.1| ada regulatory protein [Brucella ovis ATCC 25840]
    MNLMIPKTHDPDESRWQKVLDRDKASDGKFVYAVRTTGVYCRPSCPSRRGKRENVQFFNGCEDAERAGFRPCLRCKPDLS
    DTLATQNNARHAEMVASACRFIETAETQPSLEEIANVVKASPAHFHRVFKAFTGLTPKAYADAHRAGRMRAALDMPQIRV
    TDAIYDAGYNSSSRFYEASDRILGMTPKAYRAGGKDADIRFAIGQSTLGAVLVAASGKGVCAIFMGDDPQGLIHDLEKRF
    PKANLIGADRNFENLVAEVVGFVEAPGIGLDLPLDLRGTAFQQRVWRALCEIPAGETVSYTDIAERISAPRAVRAVAQAC
    AANKIAVAVP
    CHRVVRNDGGISGYRWGVERKRDLLERERKA

    >gi|148559592|ref|YP_001258401.1| hypothetical protein BOV_0384 [Brucella ovis ATCC 25840]
    MSVTIYGIKNCDTMKKARIWLEDHGIDYAFHDYKKEGLDAETLDRFLKTVPWEQLLNRAGTTFRKLPEDVRSNVDAASAR
    ELMLAQPSMVKRPVLERDGKLMVGFKPAQYEAYFKL

    >gi|148559629|ref|YP_001258495.1| thiol peroxidase [Brucella ovis ATCC 25840]
    MTIKFGDRLPAATFKVKTADGVTEMTTDDVFKGRKVVLFAVPGAFTSTCSLNHLPGYLENRDAILAKGVDQIAVVAVNDP
    FVMGAWAQSTGGEGKILFLADGSATFTKAAGLDIDLSGGGLGVRSKRYSAIVEDGVVKSLNIEEQPGQAVTSAASALLAQ
    L

    >gi|148560495|ref|YP_001258509.1| twin-arginine translocation pathway signal sequence domain-containing protein [Brucella ovis ATCC 25840]
    MLQVWRLAICCSRLYVENNSLKQDRMIRMPVALNRRHVISLAGAAAAGLAFTRGANAQQHAPEGIVDAIEIAKPGKLKDM
    VYGKADAPVTIVEYASLT
    CPHCADFKLITFPKIKEKYIDTGKARLIFRDFPFDPRATAAVMLARCAPEDHYFPMIDLFFR
    QQQWATAEDGKAALLQIAKLAGFTQESFEACLTNQQLLNDVRATVERGSKEFGVNATPTFFINGKKYAGDLSFEEMSGFI
    DSAL

    >gi|148559453|ref|YP_001258810.1| glutaredoxin-related protein [Brucella ovis ATCC 25840]
    MGDILPSCAGIWAGILKGNQMTGINDIIDNEVKNNDVVLFMKGTPGFPQCGFSGQVVQILDYLGVNYKGVNVLASDELRQ
    GIKEYSSWPTIPQLYVKGEFVGGCDIVREMFQSKELQALFNEKGIATKAA

    >gi|148559334|ref|YP_001258849.1| HesB/YadR/YfhF family protein [Brucella ovis ATCC 25840]
    MTGITVSDSAARRIAKILDSEPGKTALRVSVEGGGCSGFSYKYDLVDAQTEDDIVIEKLGARVLIDSISVPYMDGSEIDF
    VDDLMGQSFQIRNPNATASCGCGTSFAI

    >gi|148559988|ref|YP_001258886.1| putative outer membrane protein [Brucella ovis ATCC 25840]
    MKNAASITIASGIIGLVALGIGYCAGTARQASKPVQAATSTVAFNPKAVENIVRNYLLQNPELMLEVQTALETKQAHAAQ
    EQVKQVLAANQSVLFDPKHDAVFGNPNGDVTVYEFFDYN
    CGYCKRALPDMEAILKKDPNVRYVLKEFPILGPDSMRAHVV
    SQAFKALMPEKYPEFHEMLLGGHGRATEESAIADAVKLGADEAKLREKMKDPAITGAFQRTYQLAQQLNITGTPSYVIGD
    ELVPGAIGIDGLRQRIAAARDAAKK

    >gi|148560346|ref|YP_001258912.1| hesb protein [Brucella ovis ATCC 25840]
    MQQRYYNTNYSENVAKVVLSRLPHSRLDDSPAICQPVPEEFEMGRFAVITLTDAAANRVHEIMTSREDALGIRVGVKKGG
    CAGMEYTIELVTEAKAGDDLIEKDGAKVFIAPEAVLFLLGTQMDFEVTTLRTGFVFNNPNQTSACGCGESVELKPASPES
    LRQMQGTA

    >gi|148560234|ref|YP_001258931.1| arsenate reductase [Brucella ovis ATCC 25840]
    MDVTIYHNPVCGTSRKVLGMIREAGIEPHVIEYMKTPLPRDMLVELLRQMAISPRALLRAKEARYAELGLDDPALSDEVL
    IDAMISNPALMNRPVVVTPKGVRLCRPAETVQELL

    >gi|148559780|ref|YP_001258952.1| glutathione reductase [Brucella ovis ATCC 25840]
    MTGFDYDLFVIGGGSGGVRAGRLAGAIGKKVGLAEEYRMGGTCVIRGCVPKKLFVYASQFPEHFEDSAGYGWSMGEAAFD
    WKKLIAAKDKEISRLEGLYRKGLENSHVDIFASRAELIDEHTIELKADGRRVTADKILIATGGRPNTHESLPGHEY
    CISS
    NEAFHLEELPKSIVIAGGGYIAVEFANIFHGLGVETTLVYRGKEILSRFDHDIRSLLHETMEAKGIRILCGAIFEKVEKK
    ADGKLSVELSNGETLETDQAMLALGRIPNADGLGLEKAGVKIDKSGAIEVDDYSRTNVENIWAVGDVTNRVQLTPVAIHE
    AMCFLETAFKDNPTKPDHELIATAVFSQPEIGTVGLSEDEAAKKYPELEIYRALFRPMKNTLSGRSEKTLMKLVVESKSR
    KVLGAHIMGPDAGEMAQLLGISLKAGATKDDFDRTMAVHPTATEELVTMYKPTYRVVNGKKIEG

    >gi|148558916|ref|YP_001258989.1| rhodanese family protein [Brucella ovis ATCC 25840]
    MTEKSAFVVSRDWLKERLHKPGLAIVDASWYLPAAGRNGQEEYEKAHILGAVFFDQDKIADKESGLPHTLPSPEFFAQQV
    GTLGITADETVVVYDGPGMFSAPRVWWMFRVMGVKNVYVLDGGFDGWKKAGYPVTDEVTKIAATFFKPSFNKDAVVDFQE
    MRKIVDEKRSQIADARGAGRFTGRDAEPRAGMRSGHMPGARNVPVTTLSENGELKDLESLRRIFDEAGIDLSGPVVTS
    CG
    SGVTAAVITLALTSLGHKDNRLYDGSWSEWGSRQDTPVVTGEAE

    >gi|148559162|ref|YP_001259047.1| dihydrolipoamide dehydrogenase [Brucella ovis ATCC 25840]
    MVRLPQNLRRHSSAISKTRWVCWSDGTDAALVFVAYTKNSAAFPFSGIRAKIMADIYDVIFIGSGPGGYVTAIRAAQLGL
    KTAIVEREHLGGI
    CLNWGCIPTKALLRSAEILHFGEHAKDYGLKLDGTITPDVKAVVQRSRGVSARLNGGVAFLMKKNKI
    DVIWGEAKLVKAASGSNPAEISVGKTSKQPMQPQNPVPKGVLGEGSYKAKHIIVATGARPRALPGIEPDGKLIWTYFEAM
    VPQALPKSMLVMGSGAIGIEFASFYHDMGVDVTVVEVMSQIMPVEDAEISAIARKQLEKRGLKIITDAKVAKVEKGANSV
    TAHVETKDGKTQTLTVDRMISAVGVQGNIENLGLEALGVKTDRGCIVIDGYGKTNVAGIYAIGDVAGPPMLAHKAEHEGV
    ICVEKIAGLPNVHPLDKGKIPGCTYCNPQVASVGLTEAKAKEQGYDIRVGRYSFSANGKAIALGEDQGLVKTIFDRKTGQ
    LLGAHMVGAEVTELIQGFVIAMNLETTEEELMHSVFPHPTLSETMKESVLDAYGRVLNA

    >gi|148558887|ref|YP_001259378.1| thioredoxin-disulfide reductase [Brucella ovis ATCC 25840]
    MTQRHAPVIVIGSGPAGYAAAIYAARAMLKPVVIAGLQQGGQLMITTDVENYPGYAEPVQGPWMMEQMARQAENVGAQIV
    HDIITEVETTVRPFRLKGDSGTIYTCDALIIATGAQAKWLGLESEQTFMGGGVSA
    CATCDGFFYRGKDVVVVGGGNTAVE
    EALYLSHIAKSVTIVHRRDGFRAEKIMQDRLLSRENVSVVWNSVIDEILGTEARPPMGATVTGVRLKNIVTGETQERATH
    GVFIAIGHAPAVSLFEGKLKQKPNGYLWTAPDSTATDVPGIFAAGDVTDDIYRQAVTAAGMGCMAALEAERWLAAQEPLH
    EAAE

    >gi|148559479|ref|YP_001259501.1| putative disulfide bond formation protein B [Brucella ovis ATCC 25840]
    MASLTQPAGKIQAWTAGIMTIGLAVTVGIALAFEHIGGYMPCKLCLEERIPYYIGIPVLAVAWIACMAKWPPVLTRGLIL
    VGALLMTLGLALSIYHTGVELKYWPGPID
    CSAATMKITRDAGNLLNDLNTHPPACDSAPGYFLGLSFAGWNAVASLLFAA
    ISYYGAFAKSGK

    >gi|148559957|ref|YP_001259704.1| glutaredoxin 3 [Brucella ovis ATCC 25840]
    MVDVIIYTRPGCPYCARAKALLARKGAEFNEIDASATPELRAEMQERSGRNTFPQIFIGSVHVGGCDDLYALEDEGKLDS
    LLKTGKLI

    >gi|148560222|ref|YP_001259743.1| dihydrolipoamide dehydrogenase [Brucella ovis ATCC 25840]
    MSYDVVVIGTGPGGYVAAIKAAQLGLKVAVVEKRKTFGGTCLNIGCIPSKALLHASEVFAESGHSFDTLGVEVTPKLNLT
    KMLAHKDTTVKANVSGVEFLFKKNKITPYIGTGKIVGKGKVSVTSEDGKVEEIEAKNIIIATGSDVAGIPGVKVDIDEKV
    IVSSTGALSFDKVPGSLIVVGGGVIGLELGSVWARLGAKVTVVEYLDKVLGPMDGEVSKQFQRLFEKQGIAFKLGAKVTG
    VEKVGKGAKVTFEPVKGGDAETLEADAVLIATGRRPYTDGLGLQEAGVAVDERGRVAIDDHWRTNVEGIYAIGDVVQGPM
    LAHKAEDEGIAVAEIIAGQAGHVNFDVIPSVVYTQPEVASVGKTEEELKAAGIDYKVGKFPFTANGRARAMLHTDGFVKI
    LADKATDRVLGAHILGYNAGEMIHELAVLMEFGGSSEDLARTCHAHPTMSETVRESALATFAKPIHM

    >gi|148560356|ref|YP_001259797.1| putative thiol:disulfide interchange protein [Brucella ovis ATCC 25840]
    MAEDNEKATSEQNAKSGNRKIVLLAALAGVIAGIGAVYVMERPSGNVVDQNVSANLAAESDAASAQCALKADALKALDAA
    ATGGVAAMRAAEKPISLAHIAFTGPDGKKMTLGDYKGKTLLVNLWATW
    CAPCREEMPALDKLQGEKGGNDFDVVAINIDT
    GSDDKPKGFLSEIGIKNLTLHRDASMASFNELKRKNLAFGLPVTLLVDKDGCQIAAMNGPAPWDSPDAIKLIDAAKNL

    >gi|148560460|ref|YP_001259832.1| cadmium-translocating P-type ATPase [Brucella ovis ATCC 25840]
    MNQISFRVDGMDCASCAAKIDTAVRRLAGVTDVSVSVTNGTMTVNQDGSADSNEIAAKVTALGYRTVLAENGSGAAQPAA
    PAGSLSWWQTKKGRTMLACGGGLLAAYAIGHLYPAVMHWAFMAAMLIGLVPIAWCACMAAVNGTPFSIEMLMTVAAVGAI
    IIGATEEAATVVFLFLVGELLEGVAAGKARASIQSLATLVPKTAFLERNGTTREVAAESLSIGDVISVRPGDRMPADGEI
    ISGESAIDEAPVTGESTPVGKGEGDVVFAGTINGDGLLRVKVTAAAQDNTIARVVRLVEEAQEAKAPTERFINRFSTYYT
    PGVVVVAALVAILPPLFAGGVWDEWIYKGLAILLIGCPCALVISTPAAIAAALSSGARRGLLMKGGGVLETVGKITTACF
    DKTGTLTEGKPKVTDVLAGALPEDEVLRLAASLDAGSSHPLALAIVSAAEERALKLAEITQGKAHGGKGVSGVAGKSVLF
    LGSRKAANDIAAIPDALAGRIAACNDEGKTVSVLVADGRIAGAIAMRDEPRADAIAGLKKLKDGGIATLMLTGDNRRTVE
    AIGRDLGIEVRAELLPEDKQRIVGELRKEGRIVAKVGDGINDAPALAAADVGIAMGGGTDVALETADAAILHGHVSDIAE
    MVDLSKRTMRNIHQNIGIALGLKAVFLGTTVLGITGLWPAILADTGATVLVTVNALRLLRQPVR

    >gi|148560433|ref|YP_001259868.1| hypothetical protein BOV_1983 [Brucella ovis ATCC 25840]
    MTEPDSNRLAGEPSAYLRQHANNPVHWQPWGRKALDAAKELDRPILLSIGYATCHWCHVMAHESFEDDDVAAVMNAFFIN
    VKVDREERPDIDQIYMAALGAMGQQGGWPLTMFLRPDGKPFWGGTYFPRHARHNMPGFVDILHAVNNLWHRDKDKINHNA
    EAVFDHLEGRLAAQSQPLQNEISRFDDLANRIGSLIDPQRGGIEGVPKFPNAPFMDTLWLSWLYRHNETHRDNFLLSLKT
    MLQGGIYDHLGGGLCRYSTDAEWLVPHFEKMLYDNAQFIRHANYAFAETGDDLFRIRIEETVDWLIREMQLPDGCFASSL
    DADSEGEEGKFYVWTEDEIDAVLGTDAEVFKTFYAVTPGGNWEGKNILNRLHAAAETPTPPPLVEAARRKLLAHRETRIR
    PGRDDKALTDWNGLAIRALAEAGRSFARTDWLEHAVQAYRSIGSSFQDGRIAHCRMEGAFLYPALATDYAAMINAALALY
    EATGEFAYIDDARKFKRALDGSHRDSAGNYRLSALGADDVILHAYGDYDEAIPSATSQIIEALTRLFLATGDSALYEENE
    KLIEQALGRALAQQYGQIGILNACRFAGEPLSLVIAATDRTDELVSIVNRTPDPRRLDKFVLVERGKTMSLPTGGTIEPE
    HPAAWFCKGHVCLPPVDTGEALRSLL

    >gi|148560068|ref|YP_001259905.1| thioredoxin [Brucella ovis ATCC 25840]
    MATVKVDNSNFQSDVLQSSEPVVVDFWAEWCGPCKTIAPALDEIAAEMAGQVKIAKVNIDENPELAAQFGVRSIPTLLMF
    KDGELAANMVGAAPKSRLADWIKASAA