Brucella microti CCM 4915 uid59319

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|256014881|ref|YP_003104890.1| rhodanese family protein [Brucella microti CCM 4915]
    MDPMSNLPFTVAALYCFAPLPQYESLREPLAQLCCANGIKGTLLLAAEGINGTVAGSAGAIEKLIAHITAIPGLGEPELK
    YSHASEMPFHRMKVRLKREIVTMGVEGIDPLKSVGTYIAPKDWNALIADENTVVVDTRNDYEYAIGTFEGAIDPQTRTFR
    EFPEWVKQNRDRLEGKKIAMFCTGGIRCEKATAFVKGLGFDDVYHLKGGILKYLEEVPREQSMWNGECFVFDERVAVGHG
    LAESDVELCRACRRPLTPQDKLSQFFEEGVSCAGCYAERTPEDRARYAERQKQVKLAEKRGANKHIGS

    >gi|256015097|ref|YP_003105106.1| glutaredoxin-like protein nrdH [Brucella microti CCM 4915]
    MNVTVYSKPACVQCTATTRALDRQGIDYKVIDISADANAFDLVQGMGYRQVPVVVAGENHWAGFRPDMISSLA

    >gi|256015229|ref|YP_003105238.1| methionine sulfoxide reductase B [Brucella microti CCM 4915]
    MKYQKSAEAIAKLSAEQYRVTQENGTERPGTGEYLYNKEPGIYVDIVSGEPLFASSDKYESHCGWPSFTKPIERANVTEL
    TDMSHGMVRTEVRSAHGDSHLGHVFPDGPVDRGGLRY
    CINSASLRFVPKDRMEAEGYGDYLDQVEG

    >gi|256015240|ref|YP_003105249.1| hypothetical protein BMI_II454 [Brucella microti CCM 4915]
    MALYMQALLGGMLIGLSAVLLLLLNGRVAGISGIVGRLLDGKQISGNLLFIIGLLMGPVVYAWIFGAFPATDIAASWPVI
    LIAGLLVGVGTRMGSG
    CTSGHGIVGLARFSRRSLVATIVFLIAGVIAASLAGAFL

    >gi|256015306|ref|YP_003105315.1| dihydrolipoamide dehydrogenase [Brucella microti CCM 4915]
    MSEISCKLLIIGGGPGGYVCGIRAGQLGIDTVLVEKTRLGGTCLNVGCIPSKALIHAADEFHRLTTFAAKSPLGITTQNP
    AIDFARTLEWKDGIVHRLNSGVAGLLKRSRVRMFQGQARFQDGKTVLVDTDTGRQTIHAENIVIATGSVPVEIQALPFGG
    NIISSTEALSLEKIPERLAVVGGGYIGLEIGTAFAKLGSRVTVVEATDRILPQYDAELTRPVMARLKTLGVEVLTGTSAK
    GLSADGKALEIRTQDGAVKAIEADKILVTVGRKPQTDGWGLSEIRLDMDGRFIRIDDRCRTSMRGIYAIGDVTGEPMLAH
    RAMAQGEMVAEIIAGGKHAWDKRCIPAVCFTDPEIVTVGLSPDEARKAGHNIQTGLFPFQANGRAMTMERDDGIVRVVAR
    ADNHVILGIQAVGAGISELSAAFAQAVEMGARLEDIAATIHAHPTLGEGFAEASMKALGHALHV

    >gi|256015353|ref|YP_003105362.1| frnE protein, putative [Brucella microti CCM 4915]
    MTGKKITIDVVSDVVCPWCFLGRKRLEAALASLPDVEAEIRWRPFQLDPTLPPHGKDRQTYLREKFGTGSKIDDSHRQLR
    ALGEEYGIVFDFDAIIRAPNTLDAHRVIHWAAQAAPDTQDRMVGMLFSLYFEQGQDIGNHEVLVDAAASVSMDAEVVARL
    LQSEADKDTIRDEIATANRIGVRGVPCFIIDQKYAVMGAQTPDVLADAIRQTAEGFEPGIAEDR

    >gi|256015475|ref|YP_003105484.1| alkyl hydroperoxide reductase C [Brucella microti CCM 4915]
    MLGIGDKLPSFKVTGVKPGFNHHEENGVSAFEEVTEQSFPGKWKVIFFYPKDFTFVCPTEIAEFARLASEFEDRDAVVLG
    GSTDNEFVKLAWRRDHKDLNKLPIWSFADTNGSLVDGLGVRSPDGVAYRYTFVVDPDNVIQHVYATNLNVGRAPKDTLRV
    LDALQTDELCPCNREVGGETLKAA

    >gi|256015648|ref|YP_003105657.1| organic hydroperoxide resistance protein [Brucella microti CCM 4915]
    MPILYTTQSTATGGRTGSAKTADGRLSVVLDTPKELGGQGGEGTNPEQLFASGYAACFLGALKFAAAKEKISIPAESTVT
    ATVGIGPREDGTGFGLDVALSIALPGIDKAKAEELVQAAHIV
    CPYSHATRGNLDVRLSVA

    >gi|256015655|ref|YP_003105664.1| thioredoxin [Brucella microti CCM 4915]
    MTSQDNPYGGAYGGPASQMTANVSFGQPSAPANGGDLIKDTTTAGFQADVITESRKQPVLVDFWAPWCGPCKQLTPIIEK
    AVREARGAVKLVKMNIDEHPAIAGQLGIQSIPAVIAFVNGQPVDGFMGAQPETKVKEFIAKVGGPSDREAALAEAIATAK
    ELAQAGDFVQAAEIFSSILQVAPDNVDAVVGLATCMLESGDAEQARSLLGTLAAEKQNEAPVRALEARLALADQVKLIGD
    PVELERRLAADPGDYQARFDLAQVRNAQGRRDDAANELLAIMRADRAWNDDGARKQLLQFFEAWGHMDPATLTARRKLSS
    LLFS

    >gi|256015762|ref|YP_003105771.1| glutathione S-transferase, putative [Brucella microti CCM 4915]
    MKLYYKAGACSLASHIILEEAGLAYTLEAVDLKAKKTASGADYLAINPRGAVPALEVEPGVVITQNAAILQYIGDHSHVA
    AFKPAYGSLERARLQEALGFCSDLHGAFGGLFAPNLSEEARPGIIANINRRLGQLEAMLADEHSYWLGAEFTQADAYAAV
    ILGWGVGMKLDLNAYPKALRLYERVLARPNVQKAMKEEGLI

    >gi|256015796|ref|YP_003105805.1| hypothetical protein BMI_II1031 [Brucella microti CCM 4915]
    MSAHPRISITYCTQCNWLLRAAWMAQELLQTFGQDLAEVALRPGTGGVFEIRVQMPDGSEELIWERKRDGGFPEAKVLKQ
    RVRDLVWPERDLGHSDRPISS

    >gi|256015832|ref|YP_003105841.1| peptide methionine sulfoxide reductase [Brucella microti CCM 4915]
    MSFFDSYRKKMQMPSKEEVLPGRVQPIPTAAAHFVSGHPLKGPWPDGMKQVLFGMGCFWGAERLFWQVPGVYVTAVGYAG
    GITPNPTYEETCTGLTGHAEVVLVVYDPKVVTLNELLALFWEEHDPTQGMRQGNDIGTTYRSVIYTFNAVDRAVAEKSRD
    AYSQALASRGLGPVTTQIADAPDFYYAEDYHQQYLAKNPDGYCGLRGTGVSCPIPLAH

    >gi|256368469|ref|YP_003105975.1| molybdopterin biosynthesis protein MoeB [Brucella microti CCM 4915]
    MFAGMNASSRPFSPEELERYARHIVLPVIGGPGQQKLKAARVLVVGAGGLGAPVLQYLAAAGVGTLGIVDDDTVSLSNLQ
    RQIIHDTDSIGQPKVESALASIARINPHVKVEGHQLRLDAHNAEALIAGFDVVVDGSDNFATRYVLADAAAKVGRPLVTG
    AMGRFDGTVTVLMPYANGPDGAKNPSYRDLFPDAPPPGTVPS
    CAEAGVLGVLPGVIGSLQAMEVIKLVTGIGEPLVGRLL
    LYNALNVRFETIRYKARKPK

    >gi|256368564|ref|YP_003106070.1| thiol:disulfide interchange protein, thioredoxin family [Brucella microti CCM 4915]
    MTETTEKPAAQKKRASWVALLPLLIFVGLAAVFAVQLLSGKDNSIIPSVLIGKQAPLTNLPPVEGLMRDGAPVSGFNSED
    LKTGPGGKLTLVNVWGSW
    CVPCRQEHPLLMEIAKDERIRVVGINYKDQPENARRFLGDLGNPFAAVGADRAGRSAIEWGV
    YGVPETFLVDQTGKIVYKHVGPFTPESVKNDLLPAVEKALQQR

    >gi|256368649|ref|YP_003106155.1| methylated-DNA--protein-cysteine methyltransferase [Brucella microti CCM 4915]
    MESFGITVFETPIGPCGIAWRGSKIVGVEIGEADEKETRHRLRERFAGGEYAEPPAFIRQTIEKVRALLDGASPDFSDTP
    LALDSVPDLNRRVYEIILELKPGETTTYGAIARRLGDVSLSQAVGYALGKNPFPIIVP
    CHRVLGSNGKVGGFSAAGGTAT
    KLRLLNIERARTTSEPDLFGGLPLQERPQTGW

    >gi|256368681|ref|YP_003106187.1| copper-translocating P-type ATPase [Brucella microti CCM 4915]
    MNKTVKPEAVSFPVPVEGMSCASCVSSVEKAVSRVPGVDKVSVNLATERADVTFKGTPDLPAVIEAIRKAGYDVPAGSVD
    LAIEGMS
    CASCVSKVEKALSGVPGVTRASVNLATERAHVELAGQVALSELIKAVEKAGYEAHALDEARSDARAETQSEKR
    DAEAAELKKSVILAAILTLPVFILEMGSHLIPAVHMFVMDRIGMQNSWYLQFVLTTLVLFGPGLRFFKKGVPTLLRGTPD
    MNSLVVVGTFAAWGFSVVATFLPGALPEGTVNVYFEAAAMIVTLILIGRYLEARAKGRTSAAISRLVGSQAKSARVVRDG
    QAIDVPLEDVRAGDIVQVRPGEKVPVDGEVIEGASYVDESMITGEPVPVAKEKGAAVVGGTINKTGAFTFRATKVGHDMV
    ISQIIRMVQDAQADKLPIQAMVDKVTGWFVPAVMAAAAITFVLWLAIGGTAMMGYALVNAIAVVIIACPCAMGLATPTSI
    MVGTGRAAEFGVLFRRGDALQTLRDASVIAVDKTGTLTEGKPALAHFDTVEGFDKDELLALVAAVEARSEHPIADAIVAA
    AQEKGLKLAEVSAFEAVPGFGLKASVGGREVAIGADRYMAKLGADVAVFAEDAKRFGDEGQSPLYAAVDGRLAAILTVAD
    PMKETTPAAIAALHAQGLKVAMITGDNRRTAQAIARKLGIDEVVAEVLPDGKVAALKRLSAGGKRIAFVGDGINDAPALA
    AADVGLAIGTGTDIAIESADVVLMSGDLRGVVNAIAISKATIRNIGENLFWAFAYNVALIPVAGGILYPFTGTLLSPVLA
    AGAMALSSIFVLSNALRLRRLRLAVQ

    >gi|256368814|ref|YP_003106320.1| cytochrome cbb3 oxidase maturation protein CcoI [Brucella microti CCM 4915]
    MSCCVENAQIATVIQSVSPEEMQIASRALGDGLRQLDLSVPGVHCGLCIKTIEDALGKISGVAYVRVNLTARRVTLRWKD
    GETPPNVVDTLRRLGYEAHIFDMAQDKDPTFTRLLIALGVAAFASSNVMLLSVAVWSGADAATRDMFHWISGLIAFPTLV
    YSGRIFYVSAWNALRAGRVNMDVPIALAISLAFAMSVYETIHHGQHAYFDASVTLLFFLLIGRTLDYMMRARARSAVRGL
    AQLGSRGAVVIGENDERNYLPVNEIRPGMRIILAAGERVPVDAKVEEGRSELDCSIASGESDAVPVGPGSDIRAGTLNLS
    TPLVIRATAEARDSFLSEMVRLMDIAEDGRAHYRRLADRASELYVPMVHATAFLAFAGWMFYTGGDWYRSIYIAISTLII
    TCPCALALAVPIVQVVAARRLFENGIMIKDGSAMERMAEIDTAVFDKTGTLTLGQPWLINAQEIEPHYLEIAAELSLYSR
    HPLSRALALFSGATPMTPFTRIEEVPGAGIEAELDGTIYRLGKQEWACGKAETAQPSGPETCLSIDGRLVQVFRFEDRPR
    EDAANAIAALKRNGLKLGIISGDKRAAVKKLADYLGVNDYHSGVLPADKSKLVQELSSEGRKVLMVGDGLNDAPALVAAH
    VSMAPATAADIGRNAADFVFLRESLSAVPLAFAVSKEAGKLVSQNFGLSIGYNIIAVPIAVFGYVTPLVAALSMSLSSIV
    VVTNALRLRAGKQKQQARQSGAPATTMKEAHK

    >gi|256368823|ref|YP_003106329.1| twin-arginine translocation signal domain protein [Brucella microti CCM 4915]
    MMNRRQILAATAAGAATFALSGGSGLAQRVPSVAEVLYDKEIPVLGNPNGDVTIVEYFDYQCPYCKKSHADLMRVVRKDG
    NVRLVMKDWIIFGETSAYAARLVLAAEKSGNYEKAMEALMTTPGRLTRDQVDGALKKAGLDAAKLQAAYKADAKRIDGIL
    QRNMKQGEAFNFAGTPSFVIGTRLYGGVMKEKELLEAIKNARKT

    >gi|256368825|ref|YP_003106331.1| ada regulatory protein [Brucella microti CCM 4915]
    MNLMIPKTHDPDESRWQKVLDRDKASDGKFVYAVRTTGVYCRPSCPSRRGKRENVQFFNGCEDAERAGFRPCLRCKPDLS
    DTLATQNNARHAEMVASACRFIETAETQPSLEEIANVVKASPAHFHRVFKAFTGLTPKAYADAHRAGRMRAALDMPQIRV
    TDAIYDAGYNSSSRFYEASDRILGMTPKAYRAGGKDADIRFAIGQSTLGAVLVAASGKGVCAIFMGDDPQGLIHDLEKRF
    PKANLIGADRNFENLVAEVVGFVEAPGIGLDLPLDLRGTAFQQRVWRALCEIPAGETVSYTDIAERISAPRAVRAVAQAC
    AANKIAVAVP
    CHRVVRNDGGISGYRWGVERKRDLLERERKA

    >gi|256368826|ref|YP_003106332.1| arsenate reductase [Brucella microti CCM 4915]
    MSVTIYGIKNCDTMKKARIWLEDHGIDYAFHDYKKEGLDAETLDRFLKTVPWEQLLNRAGTTFRKLPEDVRSNVDAASAR
    ELMLAQPSMVKRPVLERDGKLMVGFKPAQYEAYFKL

    >gi|256368931|ref|YP_003106437.1| ahpC/TSA family protein [Brucella microti CCM 4915]
    MTIKVGDRLPAATFKVKTADGITEMTTDDVFKGRKVVLFAVPGAFTPTCSLNHLPGYLENRDAILAKGVDQIAVVAVNDP
    FVMGAWAQSTGGEGKILFLADGSATFTKAAGLDIDLSGGGLGVRSKRYSAIVEDGVVKSLNIEEQPGQAVTSAASALLAQ
    L

    >gi|256368949|ref|YP_003106455.1| twin-arginine translocation signal domain protein [Brucella microti CCM 4915]
    MPVALNRRHVISLAGAAAAGLAFTRGANAQQHAPEGIVDAIEIAKPGKLKDMVYGKADAPVTIVEYASLTCPHCADFKLI
    TFPKIKEKYIDTGKARLIFRDFPFDPRATAAVMLARCAPEDHYFPMIDLFFRQQQQWATAEDGKAALLQIAKLAGFTQES
    FEACLTNQQLLNDVRATVERGSKEFGVNATPTFFINGKKYAGDLSFEEMSGFIDSAL

    >gi|256369265|ref|YP_003106773.1| glutaredoxin-related protein [Brucella microti CCM 4915]
    MGDILPSCAGIWAGILKGNQMTGINDIIDNEVKNNDVVLFMKGTPGFPQCGFSGQVVQILDYLGVNYKGVNVLASDELRQ
    GIKEYSSWPTIPQLYVKGEFVGGCDIVREMFQSKELQALFNEKGIATKAA

    >gi|256369303|ref|YP_003106811.1| HesB/YadR/YfhF family protein [Brucella microti CCM 4915]
    MTGITVSDSAARRIAKILDSEPGKTALRVSVEGGGCSGFSYKYDLVDAQTEDDIVIEKLGARVLIDSISVPYMDGSEIDF
    VDDLMGQSFQIRNPNATASCGCGTSFAI

    >gi|256369337|ref|YP_003106845.1| outer membrane protein, putative [Brucella microti CCM 4915]
    MKNAASITIASGIIGLVALGIGYCAGTARQASKPVQAATSTVAFNPKAVENIVRNYLLQNPELMLEVQTALETKQAHAAQ
    EQVKQVLAANQSVLFDPKHDAVFGNPNGDVTVYEFFDYN
    CGYCKRALPDMEAILKKDPNVRYVLKEFPILGPDSMRAHVV
    SQAFKALMPEKYPEFHEMLLGGHGRATEESAIADAVKLGADEAKLREKMKDPAITGAFQRTYQLAQQLNITGTPSYVIGD
    ELVPGAIGIDGLRQRIAAARDAAKK

    >gi|256369350|ref|YP_003106858.1| bacterioferritin comigratory protein [Brucella microti CCM 4915]
    MAHPQVGDMAPDFTLPSDHGEITLSSLKGHPVVVYFYPKDDTSGCTREAIAFSQLKAEFDRIGVRVIGLSPDSATKHARF
    RTKHALTVDLVADEDRVALEAYGVWVEKSMYGRKYMGVERTTFLIGADGRIAQVWNKVKVDGHAQAVLEAARRL

    >gi|256369365|ref|YP_003106873.1| HesB/YadR/YfhF family protein [Brucella microti CCM 4915]
    MGRFAVITLTDAAANRVHEIMTSREDALGIRVGVKKGGCAGMEYTIELVTEAKAGDDLIEKDGAKVFIAPEAVLFLLGTQ
    MDFEVTTLRTGFVFNNPNQTSACGCGESVELKPASPESLRQMQGTA

    >gi|256369411|ref|YP_003106919.1| arsenate reductase ArsC, putative [Brucella microti CCM 4915]
    MDVTIYHNPVCGTSRKVLGMIREAGIEPHVIEYMKTPLPRDMLVELLRQMAISPRALLRAKEARYAELGLDDPALSDEVL
    IDAMISNPVLMNRPVVVTPKGVRLCRPAETVQELL

    >gi|256369435|ref|YP_003106943.1| glutathione reductase [Brucella microti CCM 4915]
    MTGFDYDLFVIGGGSGGVRAGRLAGAIGKKVGLAEEYRMGGTCVIRGCVPKKLFVYASQFPEHFEDSAGYGWSMGEAAFD
    WKKLIAAKDKEISRLEGLYRKGLENSHVDIFASRAELIDEHTIELKADGRRVTADKILIATGGRPNTHESLPGHEY
    CISS
    NEAFHLEELPKSIVIAGGGYIAVEFANIFHGLGVETTLVYRGNEILSRFDHDIRSLLHETMEAKGIRILCGAIFEKVEKK
    ADGKLSVELSNGETLETDQAMLALGRIPNTDGLGLEKAGVKIDKSGAIEVDDYSRTNVENIWAVGDVTNRVQLTPVAIHE
    AMCFLETAFKDNPTKPDHELIATAVFSQPEIGTVGLSEDEAAKKYPELEIYRALFRPMKNTLSGRSEKTLMKLVVESKSR
    KVLGAHIMGPDAGEMAQLLGISLKAGATKDDFDRTMAVHPTATEELVTMYKPTYRVVNGKKIEG

    >gi|256369480|ref|YP_003106988.1| rhodanese family protein [Brucella microti CCM 4915]
    MTEKSAFVVSRDWLKERLHKPGLAIVDASWYLPAAGRNGQEEYEKAHIPGAVFFDQDKIADKESGLPHTLPSPEFFAQQV
    GTLGITADETVVVYDGPGMFSAPRVWWMFRVMGVKNVYVLDGGFDGWKKAGYPVTDEVTKIAATFFKPSFNKDAVVDFQE
    MRKIVDEKRSQIADARGAGRFTGRDAEPRAGMRSGHMPGARNVPVTTLSENGELKDLESLRRIFDEAGIDLSGPVVTS
    CG
    SGVTAAVITLALTSLGHKDNRLYDGSWSEWGSRQDTPVVTGEAE

    >gi|256369553|ref|YP_003107063.1| dihydrolipoamide dehydrogenase [Brucella microti CCM 4915]
    MADIYDVIVIGSGPGGYVTAIRAAQLGLKTAIVEREHLGGICLNWGCIPTKALLRSAEILHFGEHAKDYGLKLDGTITPD
    VKAVVQRSRGVSARLNGGVAFLMKKNKIDVIWGEAKLVKAASGSNPAEISVGKTSKQPMQPQNPVPKGVLGEGSYKAKHI
    IVATGARPRALPGIEPDGKLIWTYFEAMVPQALPKSMLVMGSGAIGIEFASFYHDMGVDVTVVEVMSQIMPVEDAEISAI
    ARKQLEKRGLKIITDAKVAKVEKGANSVTAHVETKDGKTQTLTVDRMISAVGVQGNIENLGLEALGVKTDRGCIVIDGYG
    KTNVAGIYAIGDVAGPPMLAHKAEHEGVICVEKIAGLPNVHPLDKGKIPGCTYCNPQVASVGLTEAKAKEQGYDIRVGRY
    SFSANGKAIALGEDQGLVKTIFDRKTGQLLGAHMVGAEVTELIQGFVIAMNLETTEEELMHSVFPHPTLSETMKESVLDA
    YGRVLNA

    >gi|256369915|ref|YP_003107426.1| thioredoxin reductase [Brucella microti CCM 4915]
    MTQRHAPVIVIGSGPAGYTAAIYAARAMLKPVVIAGLQQGGQLMITTDVENYPGYAEPVQGPWMMEQMARQAENVGAQIV
    HDIITEVETTVRPFRLKGDSGTIYTCDALIIATGAQAKWLGLESEQTFMGGGVSA
    CATCDGFFYRGKDVVVVGGGNTAVE
    EALYLSHIAKSVTIVHRRDGFRAEKIMQDRLLSRENVSVVWNSVIDEILGTEARPPMGATVTGVRLKNIVTGETQERATH
    GVFIAIGHAPAVSLFEGKLKQKPNGYLWTAPDSTATDVPGIFAAGDVTDDIYRQAVTAAGMGCMAALEAERWLAAQEPLH
    EAAE

    >gi|256370055|ref|YP_003107566.1| disulfide bond formation protein B, putative [Brucella microti CCM 4915]
    MASLTQPAGKIQAWTAGIMTIGLAVTVGIALAFEHIGGYMPCKLCLEERIPYYIGIPVLAVAWIACMAKWPPVLTRGLIL
    VGALLMTIGLALSIYHTGVELKYWPGPID
    CSAATMKITRDAGNLLNDLNTHPPACDSAPGYFLGLSFAGWNAVASLLFAA
    ISYYGAFAKSGK

    >gi|256370276|ref|YP_003107787.1| glutaredoxin 3 [Brucella microti CCM 4915]
    MVDVIIYTRPGCPYCARAKALLARKGAEFNEIDASATPELRAEMQERSGRNTFPQIFIGSVHVGGCDDLYALEDEGKLDS
    LLKTGKLI

    >gi|256370320|ref|YP_003107831.1| dihydrolipoamide dehydrogenase [Brucella microti CCM 4915]
    MSYDVVVIGTGPGGYVAAIKAAQLGLKVAVVEKRKTFGGTCLNIGCIPSKALLHASEVFAEAGHSFDTLGVEVTPKLNLT
    KMLAHKDTTVKANVSGVEFLFKKNKITPYIGTGKIVGKGKVSVTSEDGKVEEIEAKNIIIATGSDVAGIPGVKVDIDEKV
    IVSSTGALSFDKVPGSLIVVGGGVIGLELGSVWARLGAKVTVVEYLDKVLGPMDGEVSKQFQRLLEKQGIAFKLGAKVTG
    VEKVGKGAKVTFEPVKGGDAETLEADAVLIATGRRPYTDGLGLQEAGVAVDERGRVAIDDHWRTNVEGIYAIGDVVQGPM
    LAHKAEDEGIAVAEIIAGQAGHVNFDVIPSVVYTQPEVASVGKTEEELKAAGIDYKVGKFPFTANGRARAMLHTDGFVKI
    LADKATDRVLGAHILGYNAGEMIHELAVLMEFGGSSEDLARTCHAHPTMSETVRESALATFAKPIHM

    >gi|256370382|ref|YP_003107893.1| thiol:disulfide interchange protein, putative [Brucella microti CCM 4915]
    MAEDNEKATSEQNAKSGNRKIVLLAALAGVIAGIGAVYVMERPSGNVVDQNVSANLAAESDAASAQCALKADALKALDAA
    ATGGVAAMRAAEKPISLAHIAFTGPDGKKMTLGDYKGKTLLVNLWATW
    CAPCREEMPALDKLQGEKGGNDFDVVAINIDT
    GSDDKPKGFLSEIGIKNLTLHRDASMASFNELKRKNLAFGLPVTLLVDKDGCQIAAMNGPAPWDSPDAIKLIDAAKNL

    >gi|256370418|ref|YP_003107929.1| cadmium-translocating P-type ATPase [Brucella microti CCM 4915]
    MNQISFRVDGMDCASCAAKIDTAVRRVKGVEDVSVSVTAGTMTVRHDGSGDIETMARKVRSLGYGVEQLAKERQAAVHDH
    HHDHGDCDGHHHDHDHHHDHAHAESPLEAAPNSLRFRVDGMD
    CASCAAKIDTAMRRLAGVTDVSVSVTNGTMTVNQDGSA
    DSNEIAAKVTALGYRTVLAENGSGAAQPAAPAGSLSWWQTKKGRTMLACGGGLLAAYAIGHLYPAVMHWAFMAAMLIGLV
    PIAWRACMAAVNGTPFSIEMLMTVAAVGAIIIGATEEAATVVFLFLVGELLEGVAAGKARASIQSLATLVPKTAFLERNG
    TTREVAAESLSIGDVISVRPGDRMPADGEIISGESAIDEAPVTGESTPVGKGEGDVVFAGTINGDGLLRVKVTAAAQDNT
    IARVVRLVEEAQEAKAPTERFINRFSTYYTPGVVVVAALVAILPPLFAGGVWDEWIYKGLAILLIGCPCALVISTPAAIA
    AALSSGARRGLLMKGGGVLETVGKITTACFDKTGTLTEGKPKVTDVLAGALPEDEVLRLAASLDAGSSHPLALAIVSAAE
    ERALKLAEITQGKAHGGKGVSGVAGKSVLFLGSRKAANDIAAIPDALAGRIAACNDEGKTVSVLVADGRIAGAIAMRDEP
    RADAIAGLKKLKDGGIATLMLTGDNRRTAEAIGRDLGIEVRAELLPEDKQRIVGELRKEGRIVAKVGDGINDAPALAAAD
    VGIAMGGGTDVALETADAAILHGHVSDIAEMVDLSKRTMRNIHQNIGIALGLKAVFLVTTVLGITGLWPAILADTGATVL
    VTVNALRLLRQPVR

    >gi|256370461|ref|YP_003107972.1| hypothetical protein BMI_I2085 [Brucella microti CCM 4915]
    MTEPDSNRLAGEPSAYLRQHANNPVHWQPWGRKALDAAKELDRPILLSIGYAACHWCHVMAHESFEDDDVAAVMNAFFIN
    VKVDREERPDIDQIYMAALGAMGQQGGWPLTMFLRPDGKPFWGGTYFPRHARHNMPGFVDILHAVNNLWHRDKDKINHNA
    EAVFDHLEGRLAAQSQPLQNEISRFDDLANRIGSLIDPQRGGIEGVPKFPNAPFMDTLWLSWLYRHNETHRDNFLLSLKT
    MLQGGIYDHLGGGLCRYSTDAEWLVPHFEKMLYDNAQFIRHANYAFAETGDDLFRIRIEETVDWLIREMQLPDGCFASSL
    DADSEGEEGKFYVWTEDEIDAVLGTDAEVFKTFYAVTPGGNWEGKNILNRLHAAAETPTPPPLVEAARRKLLAHRETRIR
    PGRDDKALTDWNGLAIRALAEAGRSFARTDWLEHAVQAYRSIGSSFQDGRIAHCRMEGAFLYPALATDYAAMINAALALY
    EATGEFAYIDDARKFKRALDGSHRDSAGNYRLSALGADDVILHAYGDYDEAIPSATSQIIEALTRLFLATGDSALYEENE
    KLIEQALGRALAQQYGQIGILNACRFAGEPLSLVIAATDRTDELVSIANRTLDPRRLDKFVLVERGKTMSLPTGGTIEPE
    HPAAWFCKGHVCLPPVDTGEALRSLL

    >gi|256370503|ref|YP_003108014.1| thioredoxin [Brucella microti CCM 4915]
    MATVKVDNSNFQSDVLQSSEPVVVDFWAEWCGPCKTIAPALDEIAAEMAGQVKIAKVNIDENPELAAQFGVRSIPTLLMF
    KDGELAANMVGAAPKSRLADWIKASAA