Brucella melitensis bv 1 16M uid57735

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|17986289|ref|NP_538923.1| thymidylate kinase [Brucella melitensis bv. 1 str. 16M]
    MGNCSMPPYPRPSIRLEATCEYSFGTRKKSPMAEPDSNRLAGEPSAYLRQHANNPVHWQPWGRKALDAAKELDRPILLSI
    GYAA
    CHWCHVMAHESFEDDDVAAVMNAFFINVKVDREERPDIDQIYMAALGAMGQQGGWPLTMFLRPDGKPFWGGTYIPR
    HARHNMPGFVDILHAVNNLWHRDKDKINHNAEAVFDHLEGRLAAQSQPLQNEISRFDDLANRIGSLIDPQRGGIEGVPKF
    PNAPFMDTLWLSWLYRHNETHRDNFLLSLKTMLQGGIYDHLGGGLCRYSTDAEWLVPHFEKMLYDNAQFIRHANYAFAET
    GDDLFRIRIEETVDWLIREMQLPDGCFASSLDADSEGEEGKFYVWTEDEIDAVLGTDAEVFKTFYAVTPGGNWEGKNILN
    RLHAAAETPTPPPLVEAARRKLLAHRETRIRPGRDDKALTDWNGLAIRALAEAGRSFARTDWLEHAVQAYRSIGSSFQDG
    RIAHCRMEGAFLYPALATDPEVQART

    >gi|17986337|ref|NP_538971.1| cation-transporting ATPase PACS [Brucella melitensis bv. 1 str. 16M]
    MSEPMNQISFRVDGMDCASCAAKIDTAVRRVKGVEDVSVSVTAGTVTAGTMTVRHDGSGDIETMARKVRSLGYGVEQLAK
    ERQAAVHDHHHDHDHHHDHAHAESPLEAAPNSLRFRVDGMD
    CASCAAKIDTAVRRLAGVTDVSVSVTNGTMTVNQDGSAD
    SNEIAAKVTALGYRTVLAENGSGAAQPAAPAGSLSWWQTKKGQTMLACGGGLLAAYAIGHLYPAVMHWAFMAAMLIGLVP
    IAWRACMAAVNGTPFSIEMLMTVAAVGAIIIGATEEAATVVFLFLVGELLEGVAAGKARASIQSLATLVPKTAFLERNGT
    TREVAAESLSIGDVISVRPGDRMPADGEIISGESAIDEAPVTGESTPVGKGEGDVVFAGTINGDGLLRVKVTAAAQDNTI
    ARVVRLVEEAQEAKAPTERFINRFSTYYTPGVVVVAALVAILPPLFAGGVWDEWIYKGLAILLIGCPCALVISTPAAIAA
    ALSSGARRDLLMKGGGVLETVGKITTACFDKTGTLTEGKPKVTDVLAGALPEDEVLRLAASLDAGSSHPLALAIVSAAEE
    RALKLAEITQGKAHGGKGVSGVAGKSVLFLGSRKAANDIAAIPDALAGRIAACNDEGKTVSVLVADGRIAGAIAMRDEPR
    ADAIAGLKKLKDGGIATLMLTGDNRRTAEAIGRDLGIEVRAELLPEDKQRIVGELRKEGRIVAKVGDGINDAPALAAADV
    GIAMGGGTDVALETADAAILHGHVSDIAEMVDLSKRTMRNIHQNIGIALGLKAVFLVTTVLGITGLWPAILADTGATVLV
    TVNALRLLRQPVR

    >gi|17986371|ref|NP_539005.1| thiol:disulfide interchange protein TLPA [Brucella melitensis bv. 1 str. 16M]
    MRAAEKPISLAHIAFTGPDGKKMTLGDYKGKTLLVNLWATWCAPCREEMPALDKLQGEKGGNDFDVVAINIDTGSDDKPK
    GFLSEIGIKNLTLHRDASMASFNELKRKNLAFGLPVTLLVDKDGCQIAAMNGPAPWDSPDAIKLIDAAKNL

    >gi|17986429|ref|NP_539063.1| dihydrolipoamide dehydrogenase [Brucella melitensis bv. 1 str. 16M]
    MSYDVVVIGTGPGGYVAAIKAAQLGLKVAVVEKRKTFGGTCLNIGCIPSKALLHASEVFAEAGHSFDTLGVEVTPKLNLT
    KMLAHKDTTVKANVSGVEFLFKKNKITPYIGTGKIVGKGKVSVTSEDGKVEEIEAKNIIIATGSDVAGIPGVKVDIDEKV
    IVSSTGALSFDKVPGSLIVVGGGVIGLELGSVWARLGAKVTVVEYLDKVLGPMDGEVSKQFQRLLEKQGIAFKLGAKVTG
    VEKVGKGAKITFEPVKGGDAETLEADAVLIATGRRPYTDGLGLQEAGVAVDERGRVAIDDHWRTNVEGIYAIGDVVQGPM
    LAHKAEDEGIAVAEIIAGQAGHVNFDVIPSVVYTQPEVASVGKTEEELKAAGINYKVGKFPFTANGRARAMLHTGGFVKI
    LADKATDRVLGAHILGYNAGEMIHELAVLMEFGGSSEDLARTCHAHPTMSETVRESALATFAKPIHM

    >gi|17986468|ref|NP_539102.1| glutaredoxin [Brucella melitensis bv. 1 str. 16M]
    MEFLMVDVIIYTRPGCPYCARAKALLARKGAEFNEIDASATPELRAEMQERSGRNTFPQIFIGSVHVGGCDDLYALEDEG
    KLDSLLKTGKLI

    >gi|17986667|ref|NP_539301.1| disulfide bond formation protein B [Brucella melitensis bv. 1 str. 16M]
    MASLTQPAGKIQAWTAGIMTIGLAVTVGIALAFEHIGGYMPCKLCLEERIPYYIGIPVLAVAWIACMAKWPPVLTRGLIL
    VGALLMTIGLALSIYHTGVELKYWPGPID
    CSAATMKITRDAGNLLNDLNTHPPACDSAPGYFLGLSFAGWNAVASLLFAA
    ISYYGAFAKSGK

    >gi|17986795|ref|NP_539429.1| thioredoxin reductase [Brucella melitensis bv. 1 str. 16M]
    MTQRHAPVIVIGSGPAGYTAAIYAARAMLKPVVIAGLQQGGQLMITTDVENYPGYAEPVQGPWMMEQMARQAENVGAQIV
    HDIITEVETTVRPFRLKGDSGTIYTCDALIIATGAQAKWLGLESEQTFMGGGVSA
    CATCDGFFYRGKDVVVVGGGNTAVE
    EALYLSHIAKSVTIVHRRDGFRAEKIMQDRLLSRENVSVVWNSVIDEILGTEARPPMGATVTGVRLKNIVTGETQERATH
    GVFIAIGHAPAVSLFEGKLKQKPNGYLWTAPDSTATDVPGIFAAGDVTDDIYRQAVTAAGMGCMAALEAERWLAAQEPLH
    EAAE

    >gi|17987140|ref|NP_539774.1| dihydrolipoamide dehydrogenase [Brucella melitensis bv. 1 str. 16M]
    MRRHSSAISKTRWVCWSDGTDAALVFVAYTKNSAAFPFSGIRAKIMADIYDVIVIGSGPGGYVTAIRAAQLGLKTAIVER
    EHLGGI
    CLNWGCIPTKALLRSAEILHFGEHAKDYGLKLDGTITPDVKAVVQRSRGVSARLNGGVAFLMKKNKIDVIWGEA
    KLVKAASGSNPAEISVGKTSKQPMQPQNPVPKGVLGEGSYKAKHIIVATGARPRALPGIEPDGKLIWTYFEAMVPQALPK
    SMLVMGSGAIGIEFASFYHDMGVDVTVVEVMSQIMPVEDAETSAIARKQLEKRGLKIITDAKVAKVEKGANSVTAHVETK
    DGKTQTLTVDRMISAVGVQGNIENLGLEALGVKTDRGCIVIDGYGKTNVAGIYAIGDVAGPPMLAHKAEHEGVICVEKIA
    GLPNVHPLDMGKIPGCTYCNPQVASVGLTEAKAKEQGYDIRVGRYSFSANGKAIALGEDQGLVKTIFDRKTGQLLGAHMV
    GAEVTELIQGFVIAMNLETTEEELMHSVFPHPTLSETMKESVLDAYGRVLNA

    >gi|17987214|ref|NP_539848.1| putative thiosulfate sulfurtransferase [Brucella melitensis bv. 1 str. 16M]
    MTEKSAFVVSRDWLKERLHKPGLAIVDASWYLPAAGRNGQEEYEKAHIPGAVFFDQDKIADKESGLPHTLPSPEFFAQQV
    GTLGITADETVVVYDGPGMFSAPRVWWMFRVMGVKNVYVLDGGFDGWKKAGYPVTDEVTKIAATFFKPSFNKDAVVDFQE
    MRKIVDEKRSQIADARGVGRFTGRDAEPRAGMRSGHMPGARNVPVTTLSENGELKDLESLRRIFDEAGIDLSGPVVTS
    CG
    SGVTAAVITLALTSLGHKDNRLYDGSWSEWGSRQDTPVVTGEAE

    >gi|161511140|ref|NP_539889.2| glutathione reductase [Brucella melitensis bv. 1 str. 16M]
    MTGFDYDLFVIGGGSGGVRAGRLAGAIGKKVGLAEEYRMGGTCVIRGCVPKKLFVYASQFPEHFEDSAGYGWSMGEAAFD
    WKKLIAAKDKEISRLEGLYRKGLENSHVDIFASRAELIDEHTIELKADGRRVTADKILIATGGRPNTHESLPGHEY
    CISS
    NEAFHLEELPKSIVIAGGGYIAVEFANIFHGLGVETTLVYRGKEILSRFDHDIRSLLHETMEAKGIRILCGAIFEKVEKK
    ADGKLSVELSNGETLETDQAMLALGRIPNTDGLGLEKAGVKIDKSGAIEVDDYSRTNVENIWAVGDVTNRVQLTPVAIHE
    AMCFLETAFKDNPTKPDHELIATAVFSQPEIGTVGLSEDEAAKKYPELEIYRALFRPMKNTLSGRSEKTLMKLVVESKSR
    KVLGAHIMGPDAGEMAQLLGISLKAGATKDDFDRTMAVHPTATEELVTMYKPTYRVVNGKKIEG

    >gi|17987275|ref|NP_539909.1| arsenate reductase [Brucella melitensis bv. 1 str. 16M]
    MDVTIYHNPVCGTSRKVLGMIREAGIEPHVIEYMKTPLPRDMLVELLRQMAISPRALLRAKEARYAELGLDDPALSDEVL
    IDAMISNPVLMNRPVVVTPKGVRLCRPAETVQELL

    >gi|17987317|ref|NP_539951.1| HESB protein [Brucella melitensis bv. 1 str. 16M]
    MPHSRLDDSPAICQPVPEEFEMGRFAVITLTDAAANRVHEIMTSREDALGIRVGVKKGGCAGMEYTIELVTEAKAGDDLI
    EKDGAKVFIAPEAVLFLLGTQMDFEVTTLRTGFVFNNPNQTSACGCGESVELKPASPESLRQMQGTA

    >gi|17987332|ref|NP_539966.1| bacterioferritin comigratory protein [Brucella melitensis bv. 1 str. 16M]
    MAHPQVGDMAPDFTLPSDHGEITLSSLKGHPVVVYFYPKDDTSGCTREAIAFSQLTAEFDRIGVRVIGLSPDSATKHARF
    RTKHALTVDLVADEDRVALEAYGVWVEKSMYGRKYMGVERTTFLIGADGRIAQVWNKVKVDGHAQAVLEAARRL

    >gi|17987343|ref|NP_539977.1| outer membrane protein [Brucella melitensis bv. 1 str. 16M]
    MVALGIGYCAGTARQASKPVQAATSTVAFNPKAVENIVRNYLLQNPELMLEVQTALETKQAHAAQEQVKQVLAANQSVLF
    DPKHDAVFGNPNGDVTVYEFFDYN
    CGYCKRALPDMEAILKKDPNVRYVLKEFPILGPDSMRAHVVSQAFKALMPEKYPEF
    HEMLLGGHGRATEESAIADAVKLGADEAKLREKMKDPAITGAFQRTYQLAQQLNITGTPSYVIGDELVPGAIGIDGLRQR
    IAAARDAAKK

    >gi|17987374|ref|NP_540008.1| HESB protein [Brucella melitensis bv. 1 str. 16M]
    MTGITVSDSAARRIAKILDSEPGKTALRVSVEGGGCSGFSYKYDLVDAQTEDDIVIEKLGARVLIDSISVPYMDGSEIDF
    VDDLMGQSFQIRNPNATASCGCGTSFAI

    >gi|17987412|ref|NP_540046.1| glutaredoxin [Brucella melitensis bv. 1 str. 16M]
    MGDILPSCAGIWAGILKGNQMTGINDIIDNEVKNNDVVLFMKGTPGFPQCGFSGQVVQILDYLGVNYKGVNVLASDELRQ
    GIKEYSSWPTIPQLYVKGEFVGGCDIVREMFQSKELQALFNEKGIATKAA

    >gi|17987723|ref|NP_540357.1| thiol:disulfide interchange protein DSBA [Brucella melitensis bv. 1 str. 16M]
    MPVALNRRHVISLAGAAAAGLAFTRGANAQQHAPEGIVDAIEIAKPGKLKDMVYGKADAPVTIVEYASLTCPHCADFKLI
    TFPKIKEKYIDTGKARLIFRDFPFDPRATAAVMLARCAPEDHYFPMIDLFFRQQQQWATAEDGKAALLQIAKLAGFTQES
    FEACLTNQQLLNDVRATVERGSKEFGVNATPTFFINGKKYAGDLSFEEMSGFIDSAL

    >gi|17987739|ref|NP_540373.1| thiol peroxidase [Brucella melitensis bv. 1 str. 16M]
    MLRHGKSKVSHKQQADQTAISIRPALRRKSMTIKVGDRLPAATFKVKTADGVTEMTTDDVFKGRKVVLFAVPGAFTPTCS
    LNHLPGYLENRDAILAKGVDQIAVVAVNDPFVMGAWAQSTGGEGKILFLADGSATFTKAAGLDIDLSGGGLGVRSKRYSA
    IVEDGVVKSLNIEEQPGQAVTSAASALLAQL

    >gi|17987840|ref|NP_540474.1| arsenate reductase [Brucella melitensis bv. 1 str. 16M]
    MSVTIYGIKNCDTMKKARIWLEDHGIDYAFHDYKKEGLDAETLDRFLKTVPWEQLLNRAGTTFRKLPEDVRSNVDAASAR
    ELMLAQPSMVKRPVLERDGKLMVGFKPAQYEAYFKL

    >gi|17987841|ref|NP_540475.1| ADA regulatory protein / O-6-methylguanine-DNA-alkyltransferase [Brucella melitensis bv. 1 str. 16M]
    MNLMIPKTHDPDESRWQKVLDRDKASDGKFVYAVRTTGVYCRPSCPSRRGKRENVQFFNGCEDAERAGFRPCLRCKPDLS
    DTLATQNNARHAEMVASACRFIETAETQPSLEEIANVVKASPAHFHRVFKAFTGLTPKAYADAHRAGRMRAALDMPQIRV
    TDAIYDAGYNSSSRFYEASDRILGMTPKAYRAGGKDADIRFAIGQSTLGAVLVAASGKGVCAIFMGDDPQGLIHDLEKRF
    PKANLIGADRNFENLVAEVVGFVEAPGIGLDLPLDLRGTAFQQRVWRALCEIPAGETVSYTDIAERISAPRAVRAVAQAC
    AANKIAVAVP
    CHRVVRNDGGISGYRWGVERKRDLLERERKA

    >gi|17987844|ref|NP_540478.1| outer membrane protein [Brucella melitensis bv. 1 str. 16M]
    MAATAAGAATFALSGGSGLAQRVPSVAEVLYDKEIPVLGNPNGDVTIVEYFDYQCPYCKKSHADLMRVVRKDGNVRLVMK
    DWIIFGETSAYAARLVLAAEKSGNYEKAMEALMTTPGRLTRDQVDGALKKAGLDAAKLQAAYKADAKRIGGILQRNMKQG
    EAFNFAGTPSFVIGTRLYGGVMKEKELLEAIKNARKT

    >gi|17987852|ref|NP_540486.1| nitrogen fixation protein FIXI (E1-E2 type cation ATPase FIXI) [Brucella melitensis bv. 1 str. 16M]
    MSCCVENAQIATVIQSVSPEEMQIASRALGDGLRQLDLSVPGVHCGLCIKTIEDALGKISGVAYVRVNLTARRVTLRWKD
    GETPPNVVDTLRRLGYEAHIFDMAQDKDPTFTRLLIALGVAAFASSNVMLLSVAVWSGADAATRDMFHWISGLIAFPTLV
    YSGRIFYVSAWNALRAGNVNMDVPIALAISLAFAMSVYETIHHGQHAYFDASVTLLFFLLIGRTLDYMMRARARSAVRGL
    AQLGSRGAVVIGENDERNYLPVNEIRPGMRIILAAGERVPVDAKVEEGRSELDCSIASGESDAVPVGPGSDIRAGTLNLS
    TPLVIRATAEARDSFLSEMVRLMDVAEDGRAHYRRLADRASELYVPMVHATAFLALAGWMFYTGGDWYRSIYIAISTLII
    TCPCALALAVPIVQVVAARRLFENGIMIKDGSAMERMAEIDTAVFDKTGTLTLGQPWLINAQEIEPHYLEIAAELSLYSR
    HPLSRALALFSGATPMTPFTRIEEVPGAGIEAELDGTIYRLGKQEWACGKAETAQPSGPETCLSIDGRLVQVFRFEDRPR
    EDAANAIAALKRNGLKLGIISGDKQAAVKKLADYLGVNDYHSGVLPADKSKLVQELSSEGRKVLMVGDGLNDAPALVAAH
    VSMAPATAADIGRNAADFVFLRESLSAVPLAFAVSKEAGKLVSQNFGLSIGYNIIAVPIAVFGYVTPLVAALSMSLSSIV
    VVTNALRLRAGKQKQQARQSGAPATTMKEAHK

    >gi|17988013|ref|NP_540647.1| copper-transporting ATPase [Brucella melitensis bv. 1 str. 16M]
    MNKTVKPEAVSFPVPVEGMSCASCVSSVEKAVSRVPGVDKVSVNLATERADVTFKGTPDLPAVIEAIRKAGYDVPAGSVD
    LAIEGMS
    CASCVSKVEKALSGVPGVTRASVNLATERAHVELAGQVALSELIKAVEKAGYEAHALDEARSDARAETQSEKR
    DAEAAELKKSVILAAILTLPAFILEMGSHLIPAVHMFVMDRIGMQNSWYLQFVLTTLVLFGPGLRFFKKGVPTLLRGTPD
    MNSLVVVGTFAAWGFSVVATFLPGALPEGTVNVYFEAAAMIVTLILIGRYLEARAKGRTSAAISRLVGLQAKSARVVRDG
    QAIDVPLEDVRAGDIVQVRPGEKVPVDGEVIEGASYVDESMITGEPVPVAKEKGAAVVGGTINKTGAFTFRATKVGHDMV
    ISQIIRMVQDAQADKLPIQAMVDKVTGWFVPAVMAAAAITFVLWLAIGGTAMMGYALVNAIAVVIIACPCAMGLATPTSI
    MVGTGRAAEFGVLFRRGDALQTLRDASVIAVDKTGTLTEGKPALAHFDMVEGFDKDELLALVAAVEARSEHPIADAIVAA
    AQEKGLKLAEVSAFEAVPGFGLKASVGGREVAIGADRYMAKLGADVAVFAEDAKRFGDEGQSPLYAAVDGRLAAILTVAD
    PMKETTPAAIAALHAQGLKVAMITGDNRRTAQAIARKLGIDEVVAEVLPDGKVAALKRLSAGGKRIAFVGDGINDAPALA
    AADVGLAIGTGTDIAIESADVVLMSGDLRGVVNAIAISKATIRNIGENLFWAFAYNVALIPVAGGILYPFTGTLLSPVLA
    AGAMALSSIFVLSNALRLRRLRLAVQ

    >gi|17988045|ref|NP_540679.1| O-6-methylguanine-DNA-alkyltransferase [Brucella melitensis bv. 1 str. 16M]
    MRKYYDFSPLNRFIRVPSAPVCFKSCYYSVMESFGITVFETPIGPCGIAWRGSKIVGVEIGEADEKETRHRLRERFAGGE
    YAEPPAFIRQTIEKVRALLDGASPDFSDTPLALDSVPDLNRRVYEIILELKPGETTTYGAIARRLGDVSLSQAVGYALGK
    NPFPIIVP
    CHRVLGSNGKVGGFSAAGGTATKLRLLNIERARTTSEPDLFGGLPLQERPQTGW

    >gi|17988132|ref|NP_540766.1| thiol:disulfide interchange protein CYCY precursor [Brucella melitensis bv. 1 str. 16M]
    MTETTEKPAAQKKRASWVALLPLLIFVGLAAVFAVQLLSGKDNSIIPSVLIGKQAPLTNLPPVEGLMRDGAPVSGFNSED
    LKTGPGGKLTLVNVWGSW
    CVPCRQEHPLLMEIAKDERIRVVGINYKDQPENARRFLGDLGNPFAAVGADRAGRSAIEWGV
    YGVPETFLVDQTGKIVYKHVGPFTPESVKNDLLPAVEKALQQR

    >gi|17988223|ref|NP_540857.1| molybdopterin biosynthesis protein MoeB [Brucella melitensis bv. 1 str. 16M]
    MLTARFGQPMFAGMNVSSRPFSPEELERYARHIVLPVIGGPGQQKLKAARVLVVGAGGLGAPVLQYLAAAGVGTLGIVDD
    DTVSLSNLQRQIIHDTDSIGQPKVESALASIARINPHVKVEGHQLRLDAHNAEALIAGFDVVVDGSDNFATRYVLADAAA
    KVGRPLVTGAMGRFDGTVTVLMPYANGPDGAKNPSYRDLFPDAPPPGTVPS
    CAEAGVLGVLPGVIGSLQAMEVIKLVTGI
    GEPLVGRLLLYNALNVRFETIRYKARKPK

    >gi|17988305|ref|NP_540939.1| thioredoxin C-1 [Brucella melitensis bv. 1 str. 16M]
    MATVKVDNSNFQSDVLQSSEPVVVDFWAEWCGPCKTIAPALDEIAAEMAGQVKIAKVNIDENPELAAQFGVRSIPTLLMF
    KDGELAANMVGAAPKSRLADWIKASAA

    >gi|17988351|ref|NP_540984.1| rhodanese-related sulfurtransferase [Brucella melitensis bv. 1 str. 16M]
    MQGNFSKKIDPMSNLPFTVAALYCFAPLPQYESLREPLAQLCCANGIKGTLLLAAEGINGTVAGSAGAIEKLIAHITAIP
    GLGEPELKYSHASEMPFHRMKVRLKREIVTMGVEGIDPLKSVGTYIAPKDWNALIADENTVVVDKRNDYEYAIGTFEGAI
    DPQTRTFREFPEWVKQNRDRLEGKKIAMFCTGGIRCEKATAFVKGLGFDDVYHLKGGILKYLEEVPREQSMWNGECFVFD
    ERVAVGHGLAESDVELCRACRRPLTPQDKLSQFFEEGVSCAGCYAERQKQVKLAEKRGANKHIGS

    >gi|17988574|ref|NP_541207.1| methionine sulfoxide reductase A [Brucella melitensis bv. 1 str. 16M]
    MSFFDSYRKKMQMPSKEEVLPGRVQPIPTAAAHFVSGHPLKGPWPDGMKQVLFGMGCFWGAERLFWQVPGVYVTAVGYAG
    GITPNPTYEETCTGLTGHAEVVLVVYDPKVVTLNELLALFWEEHDPTQGMRQGNDIGTTYRSVIYTFNAVDRAVAEKSRD
    AYSQALASRGLGPVTTQITDAPDFYYAEDYHQQYLAKNPDGYCGLRGTGVSCPIPLAH

    >gi|17988606|ref|NP_541239.1| hypothetical protein BMEII0262 [Brucella melitensis bv. 1 str. 16M]
    MSAHPRISITYCTQCNWLLRAAWMAQELLQTFGQDLAEVALRPGTGGVFEIRVQMPDGSEELIWERKRDGGFPEAKVLKQ
    RVRDLVWPERDLGHSDRPISS

    >gi|17988639|ref|NP_541272.1| glutathione S-transferase [Brucella melitensis bv. 1 str. 16M]
    MKLYYKAGACSLASHIILEEAGLAYTLEAVDLKAKKTASGADYLAINPRGAVPALEVEPGVVITQNAAILQYIGDHSHVA
    AFKPAYGSLERARLQEALGFCSDLHGAFGGLFAPNLSEEARPGIIANINRRLGQLEAMLADEHSYWLGAEFTQADAYAAV
    ILGWGVGMKLDLNAYPKALRLYERVLARPNVQKAMKEEGLI

    >gi|17988746|ref|NP_541379.1| thioredoxin [Brucella melitensis bv. 1 str. 16M]
    MRGIPMTSQDNPHGGAYGGPASQMAANVSFGQPSAPANGGDLIKDTTTAGFQADVITESRKQPVLVDFWAPWCGPCKQLT
    PIIEKAVREARGAVKLVKMNIDEHPAIAGQLGIQSIPAVIAFVNGQPVDGFMGAQPETKVKEFIAKVGGPSDQEAALAEA
    IATAKELAQAGDFVQAAEIFSSILQVAPDNVDAVVGLATCMLESGDAEQARSLLGTLAAEKQNEAPVRALEARLALADQV
    KLIGDPVELERRLAADPGDYQARFDLAQVRNAQGRRDDAANELLAIMRADRAWNDDGARKQLLQFFEAWGHMDPATLTAR
    RKLSSLLFS

    >gi|17988750|ref|NP_541383.1| ADA regulatory protein / O-6-methylguanine-DNA-alkyltransferase [Brucella melitensis bv. 1 str. 16M]
    MLFTLPNQDKLYDALVARDASYEGRAYVGVLSTGIFCRLTCPARKPKPENCRFFASVAECMADGFRPCKRCHSLQPAAEA
    EILVKKLLNALETDPERRWSEEDVVRMGFDPSTVRRSFRRHFGMTFLEMARQERLRHGFQVLAGGGRVIDAQVDAGFESP
    EAFRSAFVRIVGLPPAKLRKEGLLRADWFKTPLGTMIAICDVRSLHLLEFADRKALPAELKKLHAACRGDIGIGRFETHD
    LVERQLNAFFEGRSAVFDLPLVMHGSPFTQDVWRELQNIRAGETRSYSEIARAIEKPLAVRAVARANGANQIAIVIP
    CHR
    VIGADGALTGYGGGLWRKQKLIEIEAQYRR

    >gi|17988754|ref|NP_541387.1| osmotically inducible protein C [Brucella melitensis bv. 1 str. 16M]
    MRSNQGEIAMPILYTTQSTATGGRTGSAKTADGRLSVVLDTPKELGGQGGEGTNPEQLFASGYAACFLGALKFAAAKEKI
    SIPAESTVTATVGIGPREDGTGFGLDVALSIALPGIDKAKAEELVQAAHIV
    CPYSHATRGNLDVRLSVA

    >gi|17988922|ref|NP_541555.1| alkyl hydroperoxide reductase C22 protein [Brucella melitensis bv. 1 str. 16M]
    MLGIGDKLPPFKVTGVKPGFNHHEENGVSAFEEVTEQSFPGKWKVIFFYPKDFTFVCPTEIAEFARLASEFEDRDAVVLG
    GSTDNEFVKLAWRRDHKDLNKLPIWSFADTNGSLVDGLGVRSPDGGAYRYTFVVDPDNVIQHVYATNLNVGRAPKDTLRV
    LDALQTDELCPCNREVGGETLKAA

    >gi|17989035|ref|NP_541668.1| FRNE [Brucella melitensis bv. 1 str. 16M]
    MTGKKITIDVVSDVVCPWCFLGRKRLEAALASLPDVEAEIRWRPFQLDPTLPPHGKDRQTYLREKFGTGSKIDDSHRQLR
    ALGEEYGIVFDFDAIIRAPNTLDAHRVIHWAAQAAPDTQDRMVGMLFSLYFEQGQDIGNHEVLVDAAASVSMDAEVVARL
    LQSEADKDTIRDEIATANRIGVRGVPCFIIDQKYAVMGAQTPDVLADAIRQTAEGFEPGIAEDR

    >gi|17989090|ref|NP_541723.1| dihydrolipoamide dehydrogenase [Brucella melitensis bv. 1 str. 16M]
    MLVEKTRLGGTCLNVGCIPSKALIHAADEFHRLTTFAAKSPLGITTQNPAIDFARTLEWKDGIVHRLNSGVAGLLKRSRV
    RMFQGQARFQDGKTVLVDTDTGRQTIHAENIVIATGSVPVEIQALPFGGNIISSTEALSLEKIPERLAVVGGGYIGLEIG
    TAFAKLGSRVMVVEATDRILPQYDAELTRPVMARLKTLGVEVLTGTSAKGLSADGKALEIRTQDGAVKAIEADKILVTVG
    RKPQTDGWGLSEIRLDMDGRFIRIDDRCRTSMRGIYAIGDVTGEPMLAHRAMAQGEMVAEIIAGGKHA

    >gi|17989154|ref|NP_541787.1| hypothetical protein BMEII0809 [Brucella melitensis bv. 1 str. 16M]
    MALYMQALLGGMLIGLSAVLLLLLNGRVAGISGIVGRLLDGKQISGNLLFIIGLLMGPVVYAWIFGAFPATDIAASWPVI
    LIAGLLVGVGTRMGSG
    CTSGHGIVGLARFSRRSLVATIVFLIAGVIAASLAGAFL

    >gi|17989164|ref|NP_541797.1| methionine sulfoxide reductase B [Brucella melitensis bv. 1 str. 16M]
    MKYQKSAEAIAKLSAEQYRVTQENGTERPGTGEYLYNKEPGIYVDIVSGEPLFASSDKYESHCGWPSFTKPIERANVTEL
    TDMSHGMVRTEVRSAHGDSHLGHVFPDGPVDRGGLRY
    CINSASLRFVPKDRMEAEGYGDYLDQVEG

    >gi|17989277|ref|NP_541910.1| glutaredoxin [Brucella melitensis bv. 1 str. 16M]
    MRKTMNVTVYSKPACVQCTATTRALDRQGIDYKVIDISADANAFDLVQGMGYRQVPVVVAGENHWAGFRPDMISSLA