Brucella melitensis biovar Abortus

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|82698936|ref|YP_413510.1| molybdopterin biosynthesis protein MoeB [Brucella melitensis biovar Abortus 2308]
    MFAGMNVSSRPFSPEELERYARHIVLPVIGGPGQQKLKAARVLVVGAGGLGAPVLQYLAAAGVGTLGIVDDDTVSLSNLQ
    RQIIHDTDSIGQPKVESALASIARINPHVKVEGHQLRLDAHNAEALIAGFDVVVDGSDNFATRYVLADAAAKVGRPLVTG
    AMGRFDGTVTVLMPYANGPDGAKNPSYRDLFPDAPPPGTVPS
    CAEAGVLGVLPGVIGSLQAMEVIKLVTGIGEPLVGRLL
    LYNALNVRFETIRYKARKPK

    >gi|82699017|ref|YP_413591.1| thiol:disulfide oxidoreductase DsbE [Brucella melitensis biovar Abortus 2308]
    MTETTEKPAAQKKRASWVALLPLLIFVGLAAVFAVQLLSGKDNSIIPSVLIGKQAPLTNLPPVEGLMRDGAPVSGFNSED
    LKTGPGGKLTLVNVWGSW
    CVPCRQEHPLLMEIAKDERIRVVGINYKDQPENARRFLGDLGNPFAAVGADRAGRSAIEWGV
    YGVPETFLVDQTGKIVYKHVGPFTPESVKNDLLPAVEKALQQR

    >gi|82699099|ref|YP_413673.1| methylated-DNA-[protein]-cysteine S-methyltransferase [Brucella melitensis biovar Abortus 2308]
    MESFGITVFETPIGPCGIAWRGSKIVGVEVGEADEKETRHRLRERFAGGEYAEPPAFIRQTIEKVRALLDGASADFSDTP
    LALDSVPDLNRRVYEIILELKPGETTTYGAIARRLGDVSLSQAVGYALGKNPFPIIVP
    CHRVLGSNGKVGGFSAAGGTAT
    KLRLLNIERARTTSEPDLFGGLPLQERPQTGW

    >gi|82699274|ref|YP_413848.1| cation-transporting ATPase A [Brucella melitensis biovar Abortus 2308]
    MSCCVENAQIATVIQSVSPEEMQIASRALGDGLRQLDLSVPGVHCGLCIKTIEDALGKISGVAYVRVNLTARRVTLRWKD
    GETPPNVVDTLRRLGYEAHIFDMAQDKDPTFTRLLIALGVAAFASSNVMLLSVAVWSGADAATRDMFHWISGLIAFPTLV
    YSGRIFYVSAWNALRAGRVNMDVPIALAISLAFAMSVYETIHHGQHAYFDASVTLLFFLLIGRTLDYMMRARARSAVRGL
    AQLGSRGAVVIGENDERNYLPVNEIRPGMRIILAAGERVPVDAKVEEGRSELDCSIASGESDAVPVGPGSDIRAGTLNLS
    TPLVIRATAEARDSFLSEMVRLMDIAEDGRAHYRRLADRASELYVPMVNATAFLALAGWMFYTGGDWYRSIYIAISTLII
    TCPCALALAVPIVQVVAARRLFENGIMIKDGSAMERMAEIDTAVFDKTGTLTLGQPWLINAQEIEPHYLEIAAELSLYSR
    HPLSRALALFSGATPMTPFTRIEEVPGAGIEAELDGTIYRLGKQEWACGKAETAQPSGPETCLSIDGRLVQVFRFEDRPR
    EDAANAIAALKRNGLKLGIISGDKQAAVKKLADYLGVNDYHSGVLPADKSKLVQELSSEGRKVLMVGDGLNDAPALVAAH
    VSMAPATAADIGRNAADFVFLRESLSAVPLAFAVSKEAGKLVSQNFGLSIGYNIIAVPIAVFGYVTPLVAALSMSLSSIV
    VVTNALRLRAGKQKQQARQSGAPATTMKEAHK

    >gi|82699283|ref|YP_413857.1| DSBA oxidoreductase:twin-arginine translocation pathway signal [Brucella melitensis biovar Abortus 2308]
    MMNRRQILAATAAGAATFALSGGSGLAQRVPSVAEVLYDKEIPVLGNPNGDVTIVEYFDYQCPYCKKSHADLMRVVRKDG
    NVRLVMKDWIIFGETSAYAARLVLAAEKSGNYEKAMEALMTTPGRLTRDQVDGALKKAGLDAAKLQAAYKADAKRIDGIL
    QRNMKQGEAFNFAGTPSFVIGTRLYGGVMKEKELLEAIKNARKT

    >gi|82699284|ref|YP_413858.1| methylated-DNA-protein cysteine S-methyltransferase [Brucella melitensis biovar Abortus 2308]
    MNLMIPKTHDPDESRWQKVLDRDKASDGKFVYAVRTTGVYCRPSCPSRRGKRENVQFFNGCEDAERAGFRPCLRCKPDLS
    DTLATQNNARHAEMVASACRFIETAETQPSLEEIANVVKASPAHFHRVFKAFTGLTPKAHADAHRAGRMRAALDMPQIRV
    TDTIYDAGYNSSSRFYEASDRILGMTPKAYRAGGKDADIRFAIGQSTLGAVLVAASGKSVCAIFMGDDPQGLIHDLEKRF
    PKANLIGADRNFENLVAEVVGFVEAPGIGLDLPLDLRGTAFQQRVWRALCEIPAGETVSYTDIAERISAPRAVRAVAQAC
    AANKIAVAVP
    CHRVVRNDGGISGYRWGVERKRDLLERERKA

    >gi|82699285|ref|YP_413859.1| related:arsenate reductase and related [Brucella melitensis biovar Abortus 2308]
    MSVTIYGIKNCDTMKKARIWLEDHGIDYTFHDYKKEGLDAETLDRFLKTVPWEQLLNRAGTTFRKLPEDVRSNVDAASAR
    ELMLAQPSMVKRPVLERDGKLMVGFKPAQYEAYFKL

    >gi|82699385|ref|YP_413959.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Brucella melitensis biovar Abortus 2308]
    MTIKVGDRLPAATFKVKTADGVTEMTTDDVFKGRKVVLFAVPGAFTPTCSLNHLPGYLENRDAILAKGVDQIAVVAVNDP
    FVMGAWAQSTGGEGKILFLADGSATFTKAAGLDIDLSGGGLGVRSKRYSAIVEDGVVKSLNIEEQPGQAVTSAASALLAQ
    L

    >gi|82699402|ref|YP_413976.1| DSBA oxidoreductase:twin-arginine translocation pathway signal [Brucella melitensis biovar Abortus 2308]
    MPVALNRRHVISLAGAAAAGLAFTRGANAQQHAPEGIVDAIEIAKPGKLKDMVYGKADAPVTIVEYASLTCPHCADFKLI
    TFPKIKEKYIDTGKARLIFRDFPFDPRATAAVMLARCAPEDHYFPMIDLFFRQQQQWATAEDGKAALLQIAKLAGFTQES
    FEACLTNQQLLNDVRATVERGSKEFGVNATPTFFINGKKYAGDLSFEEMSGFIDSAL

    >gi|82699709|ref|YP_414283.1| glutaredoxin:glutaredoxin-related protein [Brucella melitensis biovar Abortus 2308]
    MGDILPSCAGIWAGILKGNQMTGINDIIDNEVKNNDVVLFMKGTPGFPQCGFSGQVVQILDYLGVNYKGVNVLASDELRQ
    GIKEYSSWPTIPQLYVKGEFVGGCDIVREMFQSKELKALFNEKGIATKAA

    >gi|82699745|ref|YP_414319.1| hypothetical protein BAB1_0894 [Brucella melitensis biovar Abortus 2308]
    MTGITVSDSAARRIAKILDSEPGKTALRVSVEGGGCSGFSYKYDLVDAQTEDDIVIEKLGARVLIDSISVPYMDGSEIDF
    VDDLMGQSFQIRNPNATASCGCGTSFAI

    >gi|82699778|ref|YP_414352.1| DSBA oxidoreductase [Brucella melitensis biovar Abortus 2308]
    MKNAASITIASGIIGLVAHGIGYCAGTARQASKPVQAATSTVAFNPKAVENIVRNYLLQNPELMLEVQTALETKQAHAAQ
    EQVKQVLAANQSVLFDPKHDAVFGNPNGDVTVYEFFDYN
    CGYCKRALPDMEAILKKDPNVRYVLKEFPILGPDSMRAHVV
    SQAFKALMPEKYPEFHEMLLGGHGRATEESAIADAVKLGADEAKLREKMKDPAITGAFQRTYQLAQQLNITGTPSYVIGD
    ELVPGAIGIDGLRQRIAAARDAAKK

    >gi|82699792|ref|YP_414366.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Brucella melitensis biovar Abortus 2308]
    MAHPQVGDMAPDFTLPSDHGEITLSSLKGHPVVVYFYPKDDTSGCTREAIAFSQLKAEFDRIGVRVIGLSPDSATKHARF
    RTKHALTVDLVADEDRVALEAYGVWVEKSMYGRKYMGVERTTFLIGADGRIAQVWNKVKVDGHAQAVLEAARRL

    >gi|82699807|ref|YP_414381.1| hypothetical protein BAB1_0956 [Brucella melitensis biovar Abortus 2308]
    MGRFAVITLTDAAANRVHEIMTSREDALGIRVGVKKGGCAGMEYTIELVTEAKAGDDLIEKDGAKVFIAPEAVLFLLGTQ
    MDFEVTTLRTGFVFNNPNQTSACGCGESVELKPASPESLRQMQGTA

    >gi|82699840|ref|YP_414414.1| arsenate reductase:arsenate reductase and related [Brucella melitensis biovar Abortus 2308]
    MDVTIYHNPVCGTSRKVLGMIREAGIEPHVIEYMKTPLPRDMLVELLRQMAISPRALLRAKEARYAELGLDDPALSDEVL
    IDAMISNPVLMNRPVVVTPKGVRLCRPAETVQELL

    >gi|82699862|ref|YP_414436.1| glutathione reductase [Brucella melitensis biovar Abortus 2308]
    MTGFDYDLFVIGGGSGGVRAGRLAGAIGKKVGLAEEYRMGGTCVIRGCVPKKLFVYASQFPEHFEDSAGYGWSMGEAAFD
    WKKLIAAKDKEISRLEGLYRKGLENSHVDIFASRAELIDEHTIELKADGRRVTADKILIATGGRPNTHESLPGHEY
    CISS
    NEAFHLEELPKSIVIAGGGYIAVEFANIFHGLGVETTLVYRGKEILSRFDHDIRSLLHETMEAKGIRILCGAIFEKVEKK
    ADGKISVELSNGETLETDQAMLALGRIPNTDGLGLEKAGVKIDKSGAIEVDDYSRTNVENIWAVGDVTNRVQLTPVAIHE
    AMCFLETAFKDNPTKPDHELIATAVFSQPEIGTVGLSEDEAAKKYPELEIYRALFRPMKNTLSGRSEKTLMKLVVESKSR
    KVLGAHIMGPDAGEMAQLLGISLKAGATKDDFDRTMAVHPTATEELVTMYKPTYRVVNGKKIEG

    >gi|82699904|ref|YP_414478.1| thiosulfate sulfurtransferase:rhodanese-like [Brucella melitensis biovar Abortus 2308]
    MTEKSAFVVSRDWLKERLHKPGLAIVDASWYLPAAGRNGQEEYEKAHIPGAVFFDQDKIADKESGLPHTLPSPEFFAQQV
    GTLGITADETVVVYDGPGMFSAPRVWWMFRVMGVKNVYVLDGGFDGWKKAGYPVTDEVTKIAATFFKPSFNKDAVVDFQE
    MRKIVDEKRSQIADARGAGRFTGRDAEPRAGMRSGHMPGARNVPVTTLSENGELKDLESLRRIFDEAGIDLSGPVVTS
    CG
    SGVTAAVITLALTSLGHKDNRLYDGSWSEWGSRQDTPVVTGEAE

    >gi|82699966|ref|YP_414540.1| dihydrolipoamide dehydrogenase [Brucella melitensis biovar Abortus 2308]
    MADIYDVIVIGSGPGGYVTAIRAAQLGLKTAIVEREHLGGICLNWGCIPTKALLRSAEILHFGEHAKDYGLKLDGTITPD
    VKAVVQRSRGVSARLNGGVAFLMKKNKIDVIWGEAKLVKAASGSNPAEISVGKTSKQPMQPQNPVPKGVLGEGSYKAKHI
    IVATGARPRALPGIEPDGKLIWTYFEAMVPQALPKSMLVMGSGAIGIEFASFYHDMGVDVTVVEVMSQIMPVEDAETSAI
    ARKQLEKRGLKIITDAKVAKVEKGANSVTAHVETKDGKTQTLTVDRMISAVGVQGNIENLGLEALGVKTDRGCIVIDGYG
    KTNVAGIYAIGDVAGPPMLAHKAEHEGVICVEKIAGLPNVHPLDMGKIPGCTYCNPQVASVGLTEAKAKEQGYDIRVGRY
    SFSANGKAIALGEDQGLVKTIFDRKTGQLLGAHMVGAEVTELIQGFVIAMNLETTEEELMHSVFPHPTLSETMKESVLDA
    YGRVLNA

    >gi|82700310|ref|YP_414884.1| pyridine nucleotide-disulphide oxidoreductase class-II [Brucella melitensis biovar Abortus 2308]
    MTQRHAPVIVIGSGPAGYTAAIYAARAMLKPVVIAGLQQGGQLMITTDVENYPGYAEPVQGPWMMEQMARQAENVGAQIV
    HDIITEVETTVRPFRLKGDSGTIYTCDALIIATGAQAKWLGLESEQTFMGGGVSA
    CSTCDGFFYRSKDVVVVGGGNTAVE
    EALYLSHIAKSVTIVHRRDGFRAEKIMQDRLLSRENVSVVWNSVIDEILGTEARPPMGATVTGVRLKNIVTGETQERATH
    GVFIAIGHAPAVSLFEGKLKQKPNGYLWTAPDSTATDVPGIFAAGDVTDDIYRQAVTAAGMGCMAALEAERWLAAQEPLH
    EAAE

    >gi|82700434|ref|YP_415008.1| basic helix-loop-helix dimerization domain-containing protein [Brucella melitensis biovar Abortus 2308]
    MASLTQPAGKIQAWTAGILTIGLAVTVGIALAFEHIGGYMPCKLCLEERIPYYIGIPVLAVAWIACMAKWPPVLTRGLIL
    VGALLMTIGLALSIYHTGVELKYWPGPID
    CSAATMKITRDAGNLLNDLNTHPPACDSAPGYFLGLSFAGWNAVASLLFAA
    ISYYGAFAKSGK

    >gi|82700648|ref|YP_415222.1| glutaredoxin [Brucella melitensis biovar Abortus 2308]
    MVDVIIYTRPGCPYCARAKALLARKGAEFNEIDASATPELRAEMQERSGRNTFPQIFIGSVHVGGCDDLYALEDEGKLDS
    LLKTGKLI

    >gi|82700684|ref|YP_415258.1| dihydrolipoamide dehydrogenase [Brucella melitensis biovar Abortus 2308]
    MSYDVVVIGTGPGGYVAAIKAAQLGLKVAVVEKRKTFGGTCLNIGCIPSKALLHASEVFAEAGHSFDTLGVEVTPKLNLT
    KMLAHKDTTVKANVSGVEFLFKKNKITPYIGTGKIVGKGKVSVTSEDGKVEEIEAKNIIIATGSDVAGIPGVKVDIDEKV
    IVSSTGALSFDKVPGSLIVVGGGVIGLELGSVWARLGAKVTVVEYLDKVLGPMDGEVSKQFQRLLEKQGIAFKLGAKVTG
    VEKVGKGAKVTFEPVKGGDAETLEADAVLIATGRRPYTDGLGLQEAGVAVDERGRVAIDDHWRTNVEGIYAIGDVVQGPM
    LAHKAEDEGIAVAEIIAGQAGHVNFDVIPSVVYTQPEVASVGKTEEELKAAGIDYKVGKFPFTANGRARAMLHTDGFVKI
    LADKATDRVLGAHILGYNAGEMIHELAVLMEFGGLSEDLARTCHAHPTMSETVRESALATFAKPIHM

    >gi|82700740|ref|YP_415314.1| sodium:dicarboxylate symporter [Brucella melitensis biovar Abortus 2308]
    MAEDNEKATSEQNAKSGNRKIVLLAALAGVIAGIGAVYVMERPSGNVVDQNVSANLAAESDAASAQCALKADALKALDAA
    ATGGVAAMRAAEKPISLAHIAFTGPDGKKMTLGDYKGKTLLVNLWATW
    CAPCREEMPALDKLQGEKGGNDFDVVAINIDT
    GSDDKPKGFLSEIGIKNLTLHRDASMASFNELKRKNLAFGLPVTLLVDKDGCQIAAMNGPAPWDSPDAIKLIDAAKNL

    >gi|82700775|ref|YP_415349.1| DNA gyrase subunit B [Brucella melitensis biovar Abortus 2308]
    MNQISFRVDGMDCASCAAKIDTAVRRVKGVEDVSVSVTAGTMTVRHDGSGDIETMARKVRSLGYGVEQLAKERQAAVHDH
    HHDHDHHHDHAHAESPLEAAPNSLRFRVDGMD
    CASCAAKIDTAVRRLAGVTDVSVSVTNGTMTVNQDGSADSNEIAAKVT
    ALGYRTVLAENGSGAAQPAAPAGSLSWWQTKKGRTMLACGGGLLAAYAIGHLYPAVMHWAFMAAMLIGLVPIAWRACMAA
    VNGTPFSIEMLMTVAAVGAIIIGATEEAATVVFLFLVGELLEGVAAGKARASIQSLATLVPKTAFLERNGTTREVAAESL
    SIGDVISVRPGDRMPADGEIISGESAIDEAPVTGESTPVGKGEGDVVFAGTINGDGLLRVKVTAAAQDNTIARVVRLVEE
    AQEAKAPTERFINRFSTYYTPGVVVVAALVAILPPLFAGGVWDEWIYKGLAILLIGCPCALVISTPAAIAAALSSGARRG
    LLMKGGGVLETVGKITTACFDKTGTLTEGKPKVTDVLADALPEDEVLRLAASLDAGSSHPLALAIVSAAEERALKLAEIT
    QGKAHGGKGVSGVAGKSVLFLGSRKAANDIAAIPDALAGRIAACNDEGKTVSVLVADGRIAGAIAMRDEPRADAIAGLKK
    LKDGGIATLMLTGDNRRTAEAIGRDLGIEVRAELLPEDKQRIVGELRKEGRIVAKVGDGINDAPALAAADVGIAMGGGTD
    VALETADAAILHGHVSDIAEMVDLSKRTMRNIHQNIGIALGLKAVFLVTTVLGITGLWPAILADTGATVLVTVNALRLLR
    QPVR

    >gi|82700818|ref|YP_415392.1| hypothetical protein BAB1_2064 [Brucella melitensis biovar Abortus 2308]
    MAEPDSNRLAGEPSAYLRQHANNPVHWQPWGRKALDAAKELDRPILLSIGYAACHWCHVMAHESFEDDDVAAVMNAFFIN
    VKVDREERPDIDQIYMAALGAMGQQGGWPLTMFLRPDGKPFWGGTYIPRHARHNMPGFVDILHAVNNLWHRDKDKINHNA
    EAVFDHLEGRLAAQSQPLQNEISRFDDLANRIGSLIDPQRGGIEGVPKFPNAPFMDTLWLSWLYRHNETHRDNFLLSLKT
    MLQGGIYDHLGGGLCRYSTDAEWLVPHFEKMLYDNAQFIRHANYAFAETGDDLFRIRIEETVDWLIREMQLPDGCFASSL
    DADSEGEEGKFYVWTEDEIDAVLGTDAEVFKTFYAVTPGGNWEGKNILNRLHAAAETPTPPPLVEAARRKLLAHRETRIR
    PGRDDKALTDWNGLAIRALAEAGRSFARTDWLEHAVQAYQSIGSSFQDGRIAHCRMEGAFLYPALATDYAAMINAALALY
    EATGEFAYIDDARKFKRALDGSHRDSAGNYRLSALGADDVILHAYGDYDEAIPSATSQIIEALTRLFLATGDSALYEENE
    KLIEQALGRALAQQYGQIGILNACRFAGEPLSLLIAATDRTDELVSIANRTPDPRRLDKFVLVERGKTMSLPTGGTIEPE
    HPAAWFCKGHVCLPPVDTGEALRSLL

    >gi|82700858|ref|YP_415432.1| thioredoxin domain-containing protein [Brucella melitensis biovar Abortus 2308]
    MATVKVDNSNFQSDVLQSSEPVVVDFWAEWCGPCKTIAPALDEIAAEMAGQVKIAKVNIDENPELAAQFGVRSIPTLLMF
    KDGELAANMVGAAPKSRLADWIKASAA

    >gi|83269039|ref|YP_418330.1| rhodanese-like protein [Brucella melitensis biovar Abortus 2308]
    MQGNFSKKIDPMSNLPFTVAALYCFAPLPQYESLREPLAQLCCANGIKGTLLLAAEGINGTVAGSAGAIEKLIAHITAIP
    GLGEPELKYSHASEMPFHRMKVRLKREIVTMGVEGIDPLKSVGTYIAPKDWNALIADENTVVVDKRNDYEYAIGTFEGAI
    DPQTRTFREFPEWVKQNRDRLEGKKIAMFCTGGIRCEKATAFVKGLGFDDVYHLKGGILKYLEEVPREQSMWNGECFVFD
    ERVAVGHGLAESDVELCRACRRPLTPQDKLSQFFEEGVSCAGCYAERTPEDRARYAERQKQVKLAEKRGANKHIGS

    >gi|83269158|ref|YP_418449.1| glutathione S-transferase [Brucella melitensis biovar Abortus 2308]
    MKLYYKAGACSLASHIILEEAGLAYTLEAVDLKAKKTASGADYLAINPRGAVPALEVEPGVVITQNAAILQYIGDHSHVA
    AFKPAYGSLERARLQEALGFCSDLHGAFGGLFAPNLSEEARPGIIANINRRLGQLEAMLADEHSYWLGAEFTQADAYAAV
    ILGWGVGMKLDLNAYPKALRLYERVLARPNVQKAMKEEGLI

    >gi|83269259|ref|YP_418550.1| thioredoxin domain-containing protein [Brucella melitensis biovar Abortus 2308]
    MTSQDNPYGGAYGGPASQMTANVSFGQPSAPANGGDLIKDTTTAGFQADVITESRKQPVLVDFWAPWCGPCKQLTPIIEK
    AVREARGAVKLVKMNIDEHPAIAGQLGIQSIPAVIAFVNGQPVDGFMGAQPETKVKEFIAKVGGPSDQEAALAEAIATVK
    ELAQAGDFVQAAEIFSSILQVAPDNVDAVVGLATCMLESGDAEQARSLLGTLAAEKQNEAPVRALEARLALADQVKLIGD
    PVELERRLAADPGDYQARFDLAQVRNAQGRRDDAANELLAIMRADRAWNDDGARKQLLQFFEAWGHMDPATLTARRKLSS
    LLFS

    >gi|83269263|ref|YP_418554.1| methylated-DNA-protein cysteine S-methyltransferase [Brucella melitensis biovar Abortus 2308]
    MLFTLPNQDKLYDALVARDASYEGRAYVGVLSTGIFCRLTCPARKPKPENCRFFASVAECMADGFRPCKRCHSLQPAAEA
    EILVKKLLNALETDPERRWSEEDVVRMGFDPSTVRRSFRRHFGMTFLEMARQERLRHGFQVLAGGGCVIDAQVDAGFESP
    EAFRSAFVRIVGLPPAKLRKEGLLRADWFKTPLGTMIAICDVRSLHLLEFADRKALPAELKKLHAACRGDIGIGRFETHD
    LVERQLNAFFEGRSAVFDLPLVMHGSPFTQDVWRELQNIRAGETRSYSEIARAIEKPLAVRAVARANGANQIAIVIP
    CHR
    VIGADGALTGYGGGLWRKQKLIEIEAQYRR

    >gi|83269267|ref|YP_418558.1| hypothetical protein BAB2_0351 [Brucella melitensis biovar Abortus 2308]
    MPILYTTQSTATGGRTGSAKTADGRLSVVLDTPKELGGQGGEGTNPEQLFASGYAACFLGALKFAAAKEKISIPAESTVT
    ATVGIGPREDGTGFGLDVALSIALPGIDKAKAEELVQAAHIV
    CPYSHATRGNLDVRLSVA

    >gi|83269430|ref|YP_418721.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Brucella melitensis biovar Abortus 2308]
    MLGIGDKLPSFKVTGVKPGFNHHEENGVSAFEEVTEQSFPGKWKVIFFYPKDFTFVCPTEIAEFARLASEFEDRDAVVLG
    GSTDNEFVKLAWRRDHKDLNKLPIWSFADTNGSLVDGLGVRSPDGVAYRYTFVVDPDNVIQHVYATNLNVGRAPKDTLRV
    LDALQTDELCPCNREVGGETLKAA

    >gi|83269547|ref|YP_418838.1| DSBA oxidoreductase [Brucella melitensis biovar Abortus 2308]
    MTGKKITIDVVSDVVCPWCFLGRKRLEAALASLPDVEAEIRWRPFQLDPTLPPHGKDRQTYLREKFGTGSKIDDSHRQLR
    ALGEEYGIVFDFDAIIRAPNTLDAHRVIHWAAQAAPDTQDRMVGMLFSLYFEQGQDIGNHEVLVDAAASVSMDAEVVARL
    LQSEADKDTIRDEIATANPIGVRGVPCFIIDQKYAVMGAQTPDVLADAIRQTAEGFEPGIAEDR

    >gi|83269595|ref|YP_418886.1| dihydrolipoamide dehydrogenase [Brucella melitensis biovar Abortus 2308]
    MLVEKTRLGGTCLNVGCIPSKALIHAADEFHCLTTFAAKSPLGITTQNPAIDFARTLEWKDGIVHRLNSGVAGLLKRSRV
    RMFQGQARFQDGKTVLVDTDTGRQTIHAENIVIATGSVPVEIQALPFGGNIISSTEALSLEKIPERLAVVGGGYIGLEIG
    TAFAKLGSRVTVVEATDRILPQYDAELTRPVMARLKTLGVEVLTGTSAKGLSADGKALEIRTQDGAVKAIEADKILVTVG
    RKPQSDGWGLSEIRLDMDGRFIRIDDRCRTSMRGIYAIGDVTGEPMLAHRAMAQGEMVAEIIAGGKHAWDKRCIPAVCFT
    DPEIVTVGLSPDEARKAGHNIQTGLFPFQANGRAMTMERDDGIVRVVARADNHVILGIQAVGAGISELSAAFAQAVEMGA
    RLEDIAATIHAHPTLGEGFAEASMKALGHALHV

    >gi|83269657|ref|YP_418948.1| Beta-ketoacyl synthase:YeeE/YedE [Brucella melitensis biovar Abortus 2308]
    MALYMQALLGGMLIGLSAVLLLLLNGRVAGISGIVGRLLDGKQISGNLLFIIGLLMGPVVYAWIFGAFPATDIAASWPVI
    LIAGLLVGVGTRMGSG
    CTSGHGIVGLARFSRRSLVATIVFLIAGVIAASLAGAFL

    >gi|83269666|ref|YP_418957.1| methionine sulfoxide reductase B [Brucella melitensis biovar Abortus 2308]
    MKYQKSAEAIAKLSAEQYRVTQENGTERLGTGEYLYNKEPGIYVDIVSGEPLFASSDKYESHCGWPSFTKPIERANVTEL
    TDMSHGMVRTEVRSAHGDSHLGHVFPDGPVDRGGLRY
    CINSASLRFVPKDRMEAEGYGDYLDQVEG

    >gi|83269752|ref|YP_419043.1| glutaredoxin [Brucella melitensis biovar Abortus 2308]
    MNVTVYSKPACVQCTATTRALDRQGIDYKVIDISADANAFDLVQGMGYRQVPVVVAGENHWAGFRPDMISSLA

    >gi|83269843|ref|YP_419134.1| selenoprotein W-related [Brucella melitensis biovar Abortus 2308]
    MSAHPRISITYCTQCNWLLRAAWMAQELLQTFGQDLAEVALRPGTGGVFEIRVQMPDGSEELIWERKRDGGFPEAKVLKQ
    RVRDLVWPERDLGHSDRPISS

    >gi|83269872|ref|YP_419163.1| methionine sulfoxide reductase A [Brucella melitensis biovar Abortus 2308]
    MSFFDSYRKKMQMPSKEEVLPGRVQPIPTAAAHFVSGHPLKGPWPDGMKQVLFGMGCFWGAERLFWQVPGVYVTAVGYAG
    GITPNPTYEETCTGLTGHAEVVLVVYDPKVVTLNELLALFWEEHDPTQGMRQGNDIGTTYRSVIYTFNAVDRAVAEKSRD
    AYSQALASRGLGPVTTQIADAPDFYYAEDYHQQYLAKNPDGYCGLRGTGVSCPIPLAH