Brucella melitensis ATCC 23457 uid59241

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|225851550|ref|YP_002731783.1| molybdopterin biosynthesis protein MoeB [Brucella melitensis ATCC 23457]
    MFAGMNVSSRPFSPEELERYARHIVLPVIGGPGQQKLKAARVLVVGAGGLGAPVLQYLAAAGVGTLGIVDDDTVSLSNLQ
    RQIIHDTDSIGQPKVESALASIARINPHVKVEGHQLRLDAHNAEALIAGFDVVVDGSDNFATRYVLADAAAKVGRPLVTG
    AMGRFDGTVTVLMPYANGPDGAKNPSYRDLFPDAPPPGTVPS
    CAEAGVLGVLPGVIGSLQAMEVIKLVTGIGEPLVGRLL
    LYNALNVRFETIRYKARKPK

    >gi|225851637|ref|YP_002731870.1| periplasmic protein thiol:disulfide oxidoreductase [Brucella melitensis ATCC 23457]
    MTETTEKPAAQKKRASWVALLPLLIFVGLAAVFAVQLLSGKDNSIIPSVLIGKQAPLTNLPPVEGLMRDGAPVSGFNSED
    LKTGPGGKLTLVNVWGSW
    CVPCRQEHPLLMEIAKDERIRVVGINYKDQPENARRFLGDLGNPFAAVGADRAGRSAIEWGV
    YGVPETFLVDQTGKIVYKHVGPFTPESVKNDLLPAVEKALQQR

    >gi|225851717|ref|YP_002731950.1| methylated-DNA--protein-cysteine methyltransferase [Brucella melitensis ATCC 23457]
    MESFGITVFETPIGPCGIAWRGSKIVGVEIGEADEKETRHRLRERFAGGEYAEPPAFIRQTIEKVRALLDGASPDFSDTP
    LALDSVPDLNRRVYEIILELKPGETTTYGAIARRLGDVSLSQAVGYALGKNPFPIIVP
    CHRVLGSNGKVGGFSAAGGTAT
    KLRLLNIERARTTSEPDLFGGLPLQERPQTGW

    >gi|225851747|ref|YP_002731980.1| heavy metal translocating P-type ATPase [Brucella melitensis ATCC 23457]
    MNKTVKPEAVSFPVPVEGMSCASCVSSVEKAVSRVPGVDKVSVNLATERADVTFKGTPDLPAVIEAIRKAGYDVPAGSVD
    LAIEGMS
    CASCVSKVEKALSGVPGVTRASVNLATERAHVELAGQVALSELIKAVEKAGYEAHALDEARSDARAETQSEKR
    DAEAAELKKSVILAAILTLPAFILEMGSHLIPAVHMFVMDRIGMQNSWYLQFVLTTLVLFGPGLRFFKKGVPTLLRGTPD
    MNSLVVVGTFAAWGFSVVATFLPGALPEGTVNVYFEAAAMIVTLILIGRYLEARAKGRTSAAISRLVGLQAKSARVVRDG
    QAIDVPLEDVRAGDIGQVRPGEKVPVDGEVIEGASYVDESMITGEPVPVAKEKGAAVVGGTINKTGAFTFRATKVGHDMV
    ISQIIRMVQDAQADKLPIQAMVDKVTGWFVPAVMAAAAITFVLWLAIGGTAMMGYALVNAIAVVIIACPCAMGLATPTSI
    MVGTGRAAEFGVLFRRGDALQTLRDASVIAVDKTGTLTEGKPALAHFDMVEGFDKDELLALVAAVEARSEHPIADAIVAA
    AQEKGLKLAEVSAFEAVPGFGLKASVGGREVAIGADRYMAKLGADVAVFAEDAKRFGDEGQSPLYAAVDGRLAAILTVAD
    PMKETTPAAIAALHAQGLKVAMITGDNRRTAQAIARKLGIDEVVAEVLPDGKVAALKRLSAGGKRIAFVGDGINDAPALA
    AADVGLAIGTGTDIAIESADVVLMSGDLRGVVNAIAISKATIRNIGENLFWAFAYNVALIPVAGGILYPFTGTLLSPVLA
    AGAMALSSIFVLSNALRLRRLRLAVQ

    >gi|225851901|ref|YP_002732134.1| heavy metal translocating P-type ATPase [Brucella melitensis ATCC 23457]
    MSCCVENAQIATVIQSVSPEEMQIASRALGDGLRQLDLSVPGVHCGLCIKTIEDALGKISGVAYVRVNLTARRVTLRWKD
    GETPPNVVDTLRRLGYEAHIFDMAQDKDPTFTRLLIALGVAAFASSNVMLLSVAVWSGADAATRDMFHWISGLIAFPTLV
    YSGRIFYVSAWNALRAGNVNMDVPIALAISLAFAMSVYETIHHGQHAYFDASVTLLFFLLIGRTLDYMMRARARSAVRGL
    AQLGSRGAVVIGENDERNYLPVNEIRPGMRIILAAGERVPVDAKVEEGRSELDCSIASGESDAVPVGPGSDIRAGTLNLS
    TPLVIRATAEARDSFLSEMVRLMDVAEDGRAHYRRLADRASELYVPMVHATAFLALAGWMFYTGGDWYRSIYIAISTLII
    TCPCALALAVPIVQVVAARRLFENGIMIKDGSAMERMDEIDTAVFDKTGTLTLGQPWLINAQEIEPHYLEIAAELSLYSR
    HPLSRALALFSGATPMTPFTRIEEVPGAGIEAELDGTIYRLGKQEWACGKAETAQPSGPETCLSIDGRLVQVFRFEDRPR
    EDAANAIAALKRNGLKLGIISGDKQAAVKKLADYLGVNDYHSGVLPADKSKLVQELSSEGRKVLMVGDGLNDAPALVAAH
    VSMAPATAADIGRNAADFVFLRESLSAVPLAFAVSKEAGKLVSQNFGLSIGYNIIAVPIAVFGYVTPLVAALSMSLSSIV
    VVTNALRLRAGKQKQQARQSGAPATTMKEAHK

    >gi|225851910|ref|YP_002732143.1| DSBA oxidoreductase [Brucella melitensis ATCC 23457]
    MMNRRQILAATAAGAVKFALSGGSGLAQRVPSVAEVLYDKEIPVLGNPNGDVTIVEYFDYQCPYCKKSHADLMRVVRKDG
    NVRLVMKDWIIFGETSAYAARLVLAAEKSGNYEKAMEALMTTPGRLTRDQVDGALKKAGLDAAKLQAAYKADAKRIGGIL
    QRNMKQGEAFNFAGTPSFVIGTRLYGGVMKEKELLEAIKNARKT

    >gi|225851911|ref|YP_002732144.1| methylated-DNA-protein-cysteine methyltransferase [Brucella melitensis ATCC 23457]
    MNLMIPKTHDPDESRWQKVLDRDKASDGKFVYAVRTTGVYCRPSCPSRRGKRENVQFFNGCEDAERAGFRPCLRCKPDLS
    DTLATQNNARHAEMVASACRFIETAETQPSLEEIANVVKASPAHFHRVFKAFTGLTPKAYADAHRAGRMRAALDMPQIRV
    TDAIYDAGYNSSSRFYEASDRILGMTPKAYRAGGKDADIRFAIGQSTLGAVLVAASGKGVCAIFMGDDPQGLIHDLEKRF
    PKANLIGADRNFENLVAEVVGFVEAPGIGLDLPLDLRGTAFQQRVWRALCEIPAGETVSYTDIAERISAPRAVRAVAQAC
    AANKIAVAVP
    CHRVVRNDGGISGYRWGVERKRDLLERERKA

    >gi|225851912|ref|YP_002732145.1| hypothetical protein BMEA_A0406 [Brucella melitensis ATCC 23457]
    MSVTIYGIKNCDTMKKARIWLEDHGIDYAFHDYKKEGLDAETLDRFLKTVPWEQLLNRAGTTFRKLPEDVRSNVDAASAR
    ELMLAQPSMVKRPVLERDGKLMVGFKPAQYEAYFKL

    >gi|225852014|ref|YP_002732247.1| redoxin domain-containing protein [Brucella melitensis ATCC 23457]
    MTIKVGDRLPAATFKVKTADGVTEMTTDDVFKGRKVVLFAVPGAFTPTCSLNHLPGYLENRDAILAKGVDQIAVVAVNDP
    FVMGAWAQSTGGEGKILFLADGSATFTKAAGLDIDLSGGGLGVRSKRYSAIVEDGVVKSLNIEEQPGQAVTSAASALLAQ
    L

    >gi|225852032|ref|YP_002732265.1| DSBA oxidoreductase [Brucella melitensis ATCC 23457]
    MPVALNRRHVISLAGAAAAGLAFTRGANAQQHAPEGIVDAIEIAKPGKLKDMVYGKADAPVTIVEYASLTCPHCADFKLI
    TFPKIKEKYIDTGKARLIFRDFPFDPRATAAVMLARCAPEDHYFPMIDLFFRQQQQWATAEDGKAALLQIAKLAGFTQES
    FEACLTNQQLLNDVRATVERGSKEFGVNATPTFFINGKKYAGDLSFEEMSGFIDSAL

    >gi|225852348|ref|YP_002732581.1| glutaredoxin-like protein [Brucella melitensis ATCC 23457]
    MTGINDIIDNEVKNNDVVLFMKGMPGFPQCGFSGQVVQILDYLGVNYKGVNVLASDELRQGIKEYSSWPTIPQLYVKGEF
    VGGCDIVREMFQSKELQALFNEKGIATKAA

    >gi|225852387|ref|YP_002732620.1| iron-sulfur cluster assembly accessory protein [Brucella melitensis ATCC 23457]
    MTGITVSDSAARRIAKILDSEPGKTALRVSVEGGGCSGFSYKYDLVDAQTEDDIVIEKLGARVLIDSISVPYMDGSEIDF
    VDDLMGQSFQIRNPNATASCGCGTSFAI

    >gi|225852421|ref|YP_002732654.1| DSBA oxidoreductase [Brucella melitensis ATCC 23457]
    MKNAASITIASGIIGLVALGIGYCAGTARQASKPVQAATSTVAFNPKAVENIVRNYLLQNPELMLEVQTALETKQAHAAQ
    EQVKQVLAANQSVLFDPKHDAVFGNPNGDVTVYEFFDYN
    CGYCKRALPDMEAILKKDPNVRYVLKEFPILGPDSMRAHVV
    SQAFKALMPEKYPEFHEMLLGGHGRATEESAIADAVKLGADEAKLREKMKDPAITGAFQRTYQLAQQLNITGTPSYVIGD
    ELVPGAIGIDGLRQRIAAARDAAKK

    >gi|225852435|ref|YP_002732668.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Brucella melitensis ATCC 23457]
    MAHPQVGDMAPDFTLPSDHGEITLSSLKGHPVVVYFYPKDDTSGCTREAIAFSQLKAEFDRIGVRVIGLSPDSATKHARF
    RTKHALTVDLVADEDRVALEAYGVWVEKSMYGRKYMGVERTTFLIGADGRIAQVWNKVKVDGHAQAVLEAARRL

    >gi|225852450|ref|YP_002732683.1| FeS assembly scaffold SufA [Brucella melitensis ATCC 23457]
    MGRFAVITLTDAAANRVHEIMTSREDALGIRVGVKKGGCAGMEYTIELVTEAKAGDDLIEKDGAKVFIAPEAVLFLLGTQ
    MDFEVTTLRTGFVFNNPNQTSACGCGESVELKPASPESLRQMQGTA

    >gi|225852494|ref|YP_002732727.1| arsenate reductase [Brucella melitensis ATCC 23457]
    MDVTIYHNPVCGTSRKVLGMIREAGIEPHVIEYMKTPLPRDMLVELLRQMAISPRALLRAKEARYAELGLDDPALSDEVL
    IDAMISNPVLMNRPVVVTPKGVRLCRPAETVQELL

    >gi|225852517|ref|YP_002732750.1| glutathione reductase [Brucella melitensis ATCC 23457]
    MTGFDYDLFVIGGGSGGVRAGRLAGAIGKKVGLAEEYRMGGTCVIRGCVPKKLFVYASQFPEHFEDSAGYGWSMGEAAFD
    WKKLIAAKDKEISRLEGLYRKGLENSHVDIFASRAELIDEHTIELKADGRRVTADKILIATGGRPNTHESLPGHEY
    CISS
    NEAFHLEELPKSIVIAGGGYIAVEFANIFHGLGVETTLVYRGKEILSRFDHDIRSLLHETMEAKGIRILCGAIFEKVEKK
    ADGKLSVELSNGETLETDQAMLALGRIPNTDGLGLEKAGVKIDKSGAIEVDDYSRTNVENIWAVGDVTNRVQLTPVAIHE
    AMCFLETAFKDNPTKPDHELIATAVFSQPEIGTVGLSEDEAAKKYPELEIYRALFRPMKNTLSGRSEKTLMKLVVESKSR
    KVLGAHIMGPDAGEMAQLLGISLKAGATKDDFDRTMAVHPTATEELVTMYKPTYRVVNGKKIEG

    >gi|225852558|ref|YP_002732791.1| 3-mercaptopyruvate sulfurtransferase [Brucella melitensis ATCC 23457]
    MTEKSAFVVSRDWLKERLHKPGLAIVDASWYLPAAGRNGQEEYEKAHIPGAVFFDQDKIADKESGLPHTLPSPEFFAQQV
    GTLGITADETVVVYDGPGMFSAPRVWWMFRVMGVKNVYVLDGGFDGWKKAGYPVTDEVTKIAATFFKPSFNKDAVVDFQE
    MRKIVDEKRSQIADARGAGRFTGRDAEPRAGMRSGHMPGARNVPVTTLSENGELKDLESLRRIFDEAGIDLSGPVVTS
    CG
    SGVTAAVITLALTSLGHKDNRLYDGSWSEWGSRQDTPVVTGEAE

    >gi|225852626|ref|YP_002732859.1| dihydrolipoamide dehydrogenase [Brucella melitensis ATCC 23457]
    MADIYDVIVIGSGPGGYVTAIRAAQLGLKTAIVEREHLGGICLNWGCIPTKALLRSAEILHFGEHAKDYGLKLDGTITPD
    VKAVVQRSRGVSARLNGGVAFLMKKNKIDVIWGEAKLVKAASGSNPAEISVGKISKQPMQPQNPVPKGVLGEGSYKAKHI
    IVATGARPRALPGIEPDGKLIWTYFEAMVPQALPKSMLVMGSGAIGIEFASFYHDMGVDVTVVEVMSQIMPVEDAETSAI
    ARKQLEKRGLKIITDAKVAKVEKGANSVTAHVETKDGKTQTLTVDRMISAVGVQGNIENLGLEALGVKTDRGCIVIDGYG
    KTNVAGIYAIGDVAGPPMLAHKAEHEGVICVEKIAGLPNVHPLDMGKIPGCTYCNPQVASVGLTEAKAKEQGYDIRVGRY
    SFSANGKAIALGEDQGLVKTIFDRKTGQLLGAHMVGAEVTELIQGFVIAMNLETTEEELMHSVFPHPTLSETMKESVLDA
    YGRVLNA

    >gi|225852978|ref|YP_002733211.1| thioredoxin-disulfide reductase [Brucella melitensis ATCC 23457]
    MTQRHAPVIVIGSGPAGYTAAIYAARAMLKPVVIAGLQQGGQLMITTDVENYPGYAEPVQGPWMMEQMARQAENVGAQIV
    HDIITEVETTVRPFRLKGDSGTIYTCDALIIATGAQAKWLGLESEQTFMGGGVSA
    CATCDGFFYRGKDVVVVGGGNTAVE
    EALYLSHIAKSVTIVHRRDGFRAEKIMQDRLLSRENVSVVWNSVIDEILGTEARPPMGATVTGVRLKNIVTGETQERATH
    GVFIAIGHAPAVSLFEGKLKQKPNGYLWTAPDSTATDVPGIFAAGDVTDDIYRQAVTAAGMGCMAALEAERWLAAQEPLH
    EAAE

    >gi|225853109|ref|YP_002733342.1| disulfide bond formation protein B [Brucella melitensis ATCC 23457]
    MASLTQPAGKIQAWTAGIMTIGLAVTVGIALAFEHIGGYIPCKLCLEERIPYYIGIPVLAVAWIACMAKWPPVLTRGLIL
    VGALLMTIGLALSIYHTGVELKYWPGPID
    CSAATMKITRDAGNLLNDLNTHPPACDSAPGYFLGLSFAGWNAVASLLFAA
    ISYYGAFAKSGK

    >gi|225853315|ref|YP_002733548.1| glutaredoxin 3 [Brucella melitensis ATCC 23457]
    MVDVIIYTRPGCPYCARAKALLARKGAEFNEIDASATPELRAEMQERSGRNTFPQIFIGSVHVGGCDDLYALEDEGKLDS
    LLKTGKLI

    >gi|225853356|ref|YP_002733589.1| dihydrolipoamide dehydrogenase [Brucella melitensis ATCC 23457]
    MSYDVVVIGTGPGGYVAAIKAAQLGLKVAVVEKRKTFGGTCLNIGCIPSKALLHASEVFAEAGHSFDTLGVEVTPKLNLT
    KMLAHKDTTVKANVSGVEFLFKKNKITPYIGTGKIVGKGKVSVTSEDGKVEEIEAKNIIIATGSDVAGIPGVKVDIDEKV
    IVSSTGALSFDKVPGSLIVVGGGVIGLELGSVWARLGAKVTVVEYLDKVLGPMDGEVSKQFQRLLEKQGIAFKLGAKVTG
    VEKVGKGAKITFEPVKGGDAETLEADAVLIATGRRPYTDGLGLQEAGVAVDERGRVAIDDHWRTNVEGIYAIGDVVQGPM
    LAHKAEDEGIAVAEIIAGQAGHVNFDVIPSVVYTQPEVASVGKTEEELKAAGIDYKVGKFPFTANGRARAMLHTDGFVKI
    LADKATDRVLGAHILGYNAGEMIHELAVLMEFGGSSEDLARTCHAHPTMSETVRESALATFAKPIHM

    >gi|225853416|ref|YP_002733649.1| redoxin domain-containing protein [Brucella melitensis ATCC 23457]
    MAEDNEKATSEQNAKSGNRKIVLLAALAGVIAGIGAVYVMERPSGNVVDQNVSANLAAESDAASAQCALKADALKALDAA
    ATGGVAAMRAAEKPISLAHIAFTGPDGKKMTLGDYKGKTLLVNLWATW
    CAPCREEMPALDKLQGEKGGNDFDVVAINIDT
    GSDDKPKGFLSEIGIKNLTLHRDASMAGFNELKRKNLAFGLPVTLLVDKDGCQIAAMNGPAPWDSPDAIKLIDAAKNL

    >gi|225853452|ref|YP_002733685.1| heavy metal translocating P-type ATPase [Brucella melitensis ATCC 23457]
    MNQISFRVDGMDCASCAAKIDTAVRRVKGVEDVSVSVTAGTMTVRHDGSGDIETMARKVRSLGYGVEQLAKERQAAVHDH
    HHDHDHHHDHAHAESPLEAAPNSLRFRVDGMD
    CASCAAKIDTAVRRLAGVTDVSVSVTNGTMTVNQDGSADSNEIAAKVT
    ALGYRTVLAENGSGAAQPAAPAGSLSWWQTKKGQTMLACGGGLLAAYAIGHLYPAVMHWAFMAAMLIGLVPIAWRACMAA
    VNGTPFSIEMLMTVAAVGAIIIGATEEAATVVFLFLVGELLEGVAAGKARASIQSLATLVPKTAFLERNGTTREVAAESL
    SIGDVISVRPGDRMPADGEIISGESAIDEAPVTGESTPVGKGKGDVVFAGTINGDGLLRVKVTAAAQDNTIARVVRLVEE
    AQEAKAPTERFINRFSTYYTPGVVVVAALVAILPPLFAGGVWDEWIYKGLAILLIGCPCALVISTPAAIAAALSSGARRD
    LLMKGGGVLETVGKITTACFDKTGTLTEGKPKVTDVLAGALPEDEVLRLAASLDAGSSHPLALAIVSAAEERALKLAEIT
    QGKAHGGKGVSGVAGKSVLFLGSRKAANDIAAIPDALAGRIAACNDEGKTVSVLVADGRIAGAIAMRDEPRADAIAGLKK
    LKDGGIATLMLTGDNRRTAEAIGRDLGIEVRAELLPEDKQRIVGELRKEGRIVAKVGDGINDAPALAAADVGIAMGGGTD
    VALETADAAILHGHVSDIAEMVDLSKRTMRNIHQNIGIALGLKAVFLVTTVLGITGLWPAILADTGATVLVTVNALRLLR
    QPVR

    >gi|225853532|ref|YP_002733765.1| thioredoxin [Brucella melitensis ATCC 23457]
    MATVKVDNSNFQSDVLQSSEPVVVDFWAEWCGPCKTIAPALDEIAAEMAGQVKIAKVNIDENPELAAQFGVRSIPTLLMF
    KDGELAANMVGAAPKSRLADWIKASAA

    >gi|225685952|ref|YP_002733924.1| rhodanese family protein [Brucella melitensis ATCC 23457]
    MSNLPFTVAALYCFAPLPQYESLREPLAQLCCANGIKGTLLLAAEGINGTVAGSAGAIEKLIAHITAIPGLGEPELKYSH
    ASEMPFHRMKVRLKREIVTMGVEGIDPLKSVGTYIAPKDWNALIADENTVVVDKRNDYEYAIGTFEGAIDPQTRTFREFP
    EWVKQNRDRLEGKKIAMFCTGGIRCEKATAFVKGLGFDDVYHLKGGILKYLEEVPREQSMWNGECFVFDERVAVGHGLAE
    SDVELCRACRRPLTPQDKLSQFFEEGVSCAGCYAERTPEDRARYAERQKQVKLAEKRGANKHIGS

    >gi|225686155|ref|YP_002734127.1| glutaredoxin-like protein NrdH [Brucella melitensis ATCC 23457]
    MNVTVYSKPACVQCTATTRALDRQGIDYKVIDISADANAFDLVQGMGYRQVPVVVAGENHWAGFRPDMISSLA

    >gi|225686252|ref|YP_002734224.1| methionine sulfoxide reductase B [Brucella melitensis ATCC 23457]
    MKYQKSAEAIAKLSAEQYRVTQENGTERPGTGEYLYNKEPGIYVDIVSGEPLFASSDKYESHCGWPSFTKPIERANVTEL
    TDMSHGMVRTEVRSAHGDSHLGHVFPDGPVDRGGLRY
    CINSASLRFVPKDRMEAEGYGDYLDQVEG

    >gi|225686261|ref|YP_002734233.1| hypothetical protein BMEA_B0436 [Brucella melitensis ATCC 23457]
    MMALYMQALLGGMLIGLSAVLLLLLNGRVAGISGIVGRLLDGKQISGNLLFIIGLLMGPVVYAWIFGAFPATDIAASCPV
    ILIAGLLVGVGTRMGSG
    CTSGHGIVGLARFSRRSLVATIVFLIAGVIAASLAGAFL

    >gi|225686319|ref|YP_002734291.1| dihydrolipoamide dehydrogenase [Brucella melitensis ATCC 23457]
    MLVEKTRLGGTCLNVGCIPSKALIHAADEFHCLTTFAAKSPLGITTQNPAIDFARTLEWKDGIVHRLNSGVAGLLKRSRV
    RMFQGQARFQDGKTVLVDTDTGRQTIHAENIVIATGSVPVEIQALPFGGNIISSTEALSLEKIPERLAVVGGGYIGLEIG
    TAFAKLGSRVMVVEATDRILPQYDAELTRPVMARLKTLGVEVLTGTSAKGLSADGKALEIRTQDGAVKAIEADKILVTVG
    RKPQTDGWGLSEIRLDMDGRFIRIDDRCRTSMRGIYAIGDVTGEPMLAHRAMAQGEMVAEIIAGGKHAWDKRCIPAVCFT
    DPEIVTVGLSLDEARKAGHNIQTGLFPFQANGRAMTMERDDGIVRVVARADNHVILGIQAVGAGISELSAAFAQAVEMGA
    RLEDIAATIHAHPTLGEGFAEASMKALGHALHV

    >gi|225686363|ref|YP_002734335.1| DSBA oxidoreductase [Brucella melitensis ATCC 23457]
    MTGKKITIDVVSDVVCPWCFLGRKRLEAALASLPDVEAEIRWRPFQLDPTLPPHGKDRQTYLREKFGTGSKIDDSHRQLR
    ALGEEYGIVFDFDAIIRAPNTLDAHRVIHWAAQAAPDTQDRMVGMLFSLYFEQGQDIGNHEVLVDAAASVSMDAEVVARL
    LQSEADKDTIRDEIATANRIGVRGVPCFIIDQKYAVMGAQTPDVLADAIRQTAEGFEPGIAEDR

    >gi|225686481|ref|YP_002734453.1| Thioredoxin peroxidase 2 [Brucella melitensis ATCC 23457]
    MLGIGDKLPPFKVTGVKPGFNHHEENGVSAFEEVTEQSFPGKWKVIFFYPKDFTFVCPTEIAEFARLALEFEDRDAVVLG
    GSTDNEFVKLAWRRDHKDLNKLPIWSFADTNGSLVDGLGVRSPDGVAYRYTFVVDPDNVIQHVYATNLNVGRAPKDTLRV
    LDALQTDELCPCNREVGGETLKAA

    >gi|225686647|ref|YP_002734619.1| OsmC family protein [Brucella melitensis ATCC 23457]
    MPILYTTQSTATGGRTGSAKTADGRLSVVLDTPKELGGQGGEGTNPEQLFASGYAACFLGALKFAAAKEKISIPAESTVT
    ATVGIGPREDGTGFGLDVALSIALPGIDKAKAEELVQAAHIV
    CPYSHATRGNLDVRLSVA

    >gi|225686651|ref|YP_002734623.1| methylated-DNA-protein-cysteine methyltransferase [Brucella melitensis ATCC 23457]
    MLFTLPNQDKLYDALVARDASYEGRAYVGVLSTGIFCRLTCPARKPKPENCRFFASVAECMADGFRPCKRCHSLQPAAEA
    EILVKKLLNALETDPERRWSEEDVVRMGFDPSTVRRSFRRHFGMTFLEMARQERLRHGFQVLAGGGRVIDAQVDAGFESP
    EAFRSAFVRIVGLPPAKLRKEGLLRADWFKTPLGTMIAICDVRSLHLLEFADRKALPAELKKLHAACRGDIGIGRFETHD
    LVERQLNAFFEGRSAVFDLPLVMHGSPFTQDVWRELQNIRAGETRSYSEIARAIEKPLAVRAVARANGANQIAIVIP
    CHR
    VIGADGALTGYGGGLWRKQKLIEIEAQYRR

    >gi|225686655|ref|YP_002734627.1| thioredoxin [Brucella melitensis ATCC 23457]
    MTSQDNPHGGAYGGPASQMAANVSFGQPSAPANGGDLIKDTTTAGFQADVITESRKQPVLVDFWAPWCGPCKQLTPIIEK
    AVREARGAVKLVKMNIDEHPAIAGQLGIQSIPAVIAFVNGQPVDGFMGAQPETKVKEFIAKVGGPSDQEAALAEAIATAK
    ELAQAGDFVQAAEIFSSILQVAPDNVDAVVGLATCMLESGDAEQARSLLGTLAAEKQNEAPVRALEARLALADQVKLIGD
    PVELERRLAADPGDYQARFDLAQVRNAQGRRDDAANELLAIMRADRAWNDDGARKQLLQFFEAWGHMDPATLTARRKLSS
    LLFS

    >gi|225686758|ref|YP_002734730.1| glutathione S-transferase [Brucella melitensis ATCC 23457]
    MKLYYKAGACSLASHIILEEAGLAYTLEAVDLKAKKTASGADYLAINPRGAVPALEVEPGVVITQNAAILQYIGDHSHVA
    AFKPAYGSLERARLQEALGFCSDLHGAFGGLFAPNLSEEARPGIIANINRRLGQLEAMLADEHSYWLGAEFTQADAYAAV
    ILGWGVGMKLDLNAYPKALRLYERVLARPNVQKAMKEEGLI

    >gi|225686791|ref|YP_002734763.1| Selenoprotein W-related family protein [Brucella melitensis ATCC 23457]
    MSAHPRISITYCTQCNWLLRAAWMAQELLQTFGQDLAEVALRPGTGGVFEIRVQMPDGSEELIWERKRDGGFPEAKVLKQ
    RVRDLVWPERDLGHSDRPISS

    >gi|225686821|ref|YP_002734793.1| methionine sulfoxide reductase A [Brucella melitensis ATCC 23457]
    MSFFDSYRKKMQMPSKEEVLPGRVQPIPTAAAHFVSGHPLKGPWPDGMKQVLFGMGCFWGAERLFWQVPGVYVTAVGYAG
    GITPNPTYEETCTGLTGHAEVVLVVYDPKVVTLNELLALFWEEHDPTQGMRQGNDIGTTYRSVIYTFNAVDRAVAEKSRD
    AYSQALASRGLGPVTTQITEAPDFYYAEDYHQQYLAKNPDGYCGLRGTGVSCPIPLAH