Brucella canis ATCC 23365 uid59009

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|161617995|ref|YP_001591882.1| molybdopterin biosynthesis protein MoeB [Brucella canis ATCC 23365]
    MFAGMNASSRPFSPEELERYARHIVLPVIGGPGQQKLKAARVLVVGAGGLGAPALQYLAAAGVGTLGIVDDDTVSLSNLQ
    RQIIHDTDSIGQPKVESALASIARINPHVKVEGHQLRLDAHNAEALIAGFDVVVDGSDNFATRYVLADAAAKVGRPLVTG
    AMGRFDGTVTVLMPYANGPDGAKNPSYRDLFPDAPLPGTVPS
    CAEAGVLGVLPGVIGSLQAMEVIKLVTGIGEPLVGRLL
    LYNALNVRFETIRYKARKPK

    >gi|161618085|ref|YP_001591972.1| DsbE subfamily periplasmic protein thiol:disulfide oxidoreductase [Brucella canis ATCC 23365]
    MTETTEKPAAQKKRASWVALLPLLIFVGLAAVFAVQLLSGKDNSIIPSVLIGKQAPLTNLPPVEGLMRDGAPVSGFNSED
    LKTGPGGKLTLVNVWGSW
    CVPCRQEHPLLMEIAKDERIRVVGINYKDQPENARRFLGDLGNPFAAVGADRAGRSAIEWGV
    YGVPETFLVDQTGKIVYKHVGPFTPESVKNDLLPAVEKALQQR

    >gi|161618173|ref|YP_001592060.1| methylated-DNA-[protein]-cysteine S-methyltransferase [Brucella canis ATCC 23365]
    MESFGITVFETPIGPCGIAWRGSKIVGVEIGEADEKETRHRLRERFAGGEYAEPPAFIRQTIEKVRALLDGASPDFSDTP
    LALDSVPDLNRRVYEIILELKPGETTTYGAIARRLGDVSLSQAVGYALGKNPFPIIVP
    CHRVLGSNGKVGGFSAAGGTAT
    KLRLLNIERARTTSEPNLFGGLPLQERPQTGW

    >gi|161618201|ref|YP_001592088.1| heavy metal translocating P-type ATPase [Brucella canis ATCC 23365]
    MNKTVKPEAVSFPVPVEGMSCASCVSSVEKAVSRVPGVDKVSVNLATERADVTFKGTPDLPAVIEAIRKAGYDVPAGSVD
    LAIEGMS
    CASCVSKVEKALSGVPGVTRASVNLATERAHVELAGQVALSELIKAVEKAGYEAHALDEARSDARAEAQSEKR
    DAEAAELKKSVILAAILTLPVFILEMGSHLIPAVHMFVMDRIGMQNSWYLQFVLTTLVLFGPGLRFFKKGVPTLLRGTPD
    MNSLVVVGTFAAWGFSVVATFLPGALPEGTVNVYFEAAAMIVTLILIGRYLEARAKGRTSAAISRLVGLQAKSARVVRDG
    QAIDVPLEDVRAGDIVQVRPGEKVPVDGEVIEGASYVDESMITGEPVPVAKEKGAAVVGGTINKTGAFTFRATKVGHDMV
    ISQIIRMVQDAQADKLPIQAMVDKVTGWFVPAVMAAAAITFVLWLAIGGTAMMGYALVNAIAVVIIACPCAMGLATPTSI
    MVGTGRAAEFGVLFRRGDALQTLRDASVIAVDKTGTLTEGKPALAHFDTVEGFDKDELLALVAAVEARSEHPIADAIVAA
    AQEKGLKLAEVSAFEAVPGFGLKASVGGREVAIGADRYMAKLGADVAVFAEDAKRFGDEGQSPLYAAVDGRLAAILTVAD
    PMKETTPAAIAALHAQGLKVAMITGDNRRTAQAIARKLGIDEVVAEVLPDGKVAALKRLSAGGKRIAFVGDGINDAPALA
    AADVGLAIGTGTDIAIESADVVLMSGDLRGVVNAIAISKATIRNIGENLFWAFAYNVALIPVAGGILYPFTGTLLSPVLA
    AGAMALSSIFVLSNALRLRRLRLAVQ

    >gi|161618337|ref|YP_001592224.1| heavy metal translocating P-type ATPase [Brucella canis ATCC 23365]
    MSCCVENAQIATVIQSVSPEEMQIASRALGDGLRQLDLSVPGVHCGLCIKTIEDALGKISGVAYVRVNLTARRVTLRWKD
    GETPPNVVDTLRRLGYEAHIFDMAQDKDPTFTRLLIALGVAAFASSNVMLLSVAVWSGADAATRDMFHWISGLIAFPTLV
    YSGRIFYVSAWNALRAGRVNMDVPIALAISLAFAMSVYETIHHGQHAYFDASVTLLFFLLIGRTLDYMMRARARSAVRGL
    AQLGSRGAVVIGENDERNYLPVNEIRPGMRIILAAGERVPVDAKVEEGRSELDCSIASGESDAVPVGPGSDIRAGTLNLS
    TPLVIRATAEARDSFLSEMVRLMDIAEDGRAHYRRLADRASELYVPMVHATAFLAFAGWMFYTGGDWYRSIYIAISTLII
    TCPCALALAVPIVQVVAARRLFENGIMIKDGSAMERMAEIDTAVFDKTGTLTLGQPWLINAQEIEPHYLEIAAELSLYSR
    HPLSRVLALFSGATPMTPFTHIEEVPGAGIEAELDGTIYRLGKQEWACGKAETAQPSGPETCLSIDGRLVQVFRFEDRPR
    EDAANAIAALKRNGLKLGIISGDKQAAVKKLADYLGVNDYHSGVLPADKSKLVQELSSEGRKVLMVGDGLNDAPALVAAH
    VSMAPATAADIGRNAADFVFLRESLSAVPLAFAVSKEAGKLVSQNFGLSIGYNIIAVPIAVFGYVTPLVAALSMSLSSIV
    VVTNALRLRAGKQKQQARQSGAPATTMKEAHK

    >gi|161618346|ref|YP_001592233.1| DSBA oxidoreductase [Brucella canis ATCC 23365]
    MMNRRQILAATAAGAATFALSGGSGLAQRVPSVAEVLYDKEIPVLGNPNGDVTIVEYFDYQCPYCKKSHADLMRVVRKDG
    NVRLVMKDWIIFGETSAYAARLVLAAEKSGNYEKAMEALMTTPGRLTRDQVDGALKKAGLDAAKLQAAYKADAKRIDGIL
    QRNMKQGEAFNFAGTPSFVIGTRLYGGVMKEKELLEAIKNARKT

    >gi|161618348|ref|YP_001592235.1| methylated-DNA-[protein]-cysteine S-methyltransferase [Brucella canis ATCC 23365]
    MNLMIPKTHDPDESRWQKVLDRDKASDGKFVYAVRTTGVYCRPSCPSRRGKRENVQFFNGCEDAERAGFRPCLRCKPDLS
    DTLATQNNARHAEMVASACRFIETAETQPSLEEIANVVKASPAHFHRVFKAFTGLTPKAYADAHRAGRMRAALDMPQIRV
    TDAIYDAGYNSSSRFYEASDRILGMTPKAYRAGGKDADIRFAIGQSTLGAVLVAASGKGVCAIFMGDDPQGLIHDLEKRF
    PKANLIGADRNFENLVAEVVGFVEAPGIGLDLPLDLRGTAFQQRVWRALCEIPAGETVSYTDIAERISAPRAVRAVAQAC
    AANKIAVAVP
    CHRVVRNDGGISGYRWGVERKRDLLERERKA

    >gi|161618349|ref|YP_001592236.1| hypothetical protein BCAN_A0377 [Brucella canis ATCC 23365]
    MSVTIYGIKNCDTMKKARIWLEDHGIDYAFHDYKKEGLDAETLDRFLKTVPWEQLLNRAGTTFRKLPEDVRSNVDAASAR
    ELMLAQPSMVKRPVLERDGKLMVGFKPAQYEAYFKL

    >gi|161618449|ref|YP_001592336.1| redoxin domain-containing protein [Brucella canis ATCC 23365]
    MTIKVGDRLPAATFKVKTADGVTEMTTDDVFKGRKVVLFAVPGAFTPTCSLNHLPGYLENRDAILAKGVDQIAVVAVNDP
    FVMGAWAQSTGGEGKILFLADGSATFTKAAGLDIDLSGGGLGVRSKRYSAIVEDGVVKSLNIEEQPGQAVTSAASALLAQ
    L

    >gi|161618469|ref|YP_001592356.1| DSBA oxidoreductase [Brucella canis ATCC 23365]
    MPVALNRRHVISLAGAAAAGLAFTRGANAQQHAPEGIVDAIEIAKPGKLKDMVYGKADAPVTIVEYASLTCPHCADFKLI
    TFPKIKEKYIDTGKARLIFRDFPFDPRATAAVMLARCAPEDHYFPMIDLFFRQQQQWATAEDGKAALLQIAKLAGFTQES
    FEACLTNQQLLNDVRATVERGSKEFGVNATPTFFINGKKYAGDLSFEEMSGFIDSAL

    >gi|161618799|ref|YP_001592686.1| glutaredoxin-like protein [Brucella canis ATCC 23365]
    MTGINDIIDNEVKNNDVVLFMKGTPGFPQCGFSGQVVQILDYLGVNYKGVNVLASDELRQGIKEYSSWPTIPQLYVKGEF
    VGGCDIVREMFQSKELQALFNEKGIATKAA

    >gi|161618835|ref|YP_001592722.1| iron-sulfur cluster assembly accessory protein [Brucella canis ATCC 23365]
    MTGITVSDSAARRIAKILDSEPGKTALRVSVEGGGCSGFSYKYDLVDAQTEDDIVIEKLGARVLIDSISVPYMDGSEIDF
    VDDLMGQSFQIRNPNATASCGCGTSFAI

    >gi|161618867|ref|YP_001592754.1| DSBA oxidoreductase [Brucella canis ATCC 23365]
    MKNAASITIASGIIGLVALGIGYCAGTARQASKPVQAATSTVAFNPKAVENIVRNYLLQNPELMLEVQTALETKQAHAAQ
    EQVKQVLAANQSVLFDPKHDAVFGNPNGDVTVYEFFDYN
    CGYCKRALPDMEAILKKDPNVRYVLKEFPILGPDSMRAHVV
    SQAFKALMPEKYPEFHEMLLGGHGRATEESAIADAVKLGADEAKLREKMKDPAITGAFQRTYQLAQQLNITGTPSYVIGD
    ELVPGAIGIDGLRQRIAAARDAAKK

    >gi|161618880|ref|YP_001592767.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Brucella canis ATCC 23365]
    MAHPQVGDMAPDFTLPSDHGEITLSSLKGHPVVVYFYPKDDTSGCTREAIAFSQLKAEFDRIGVRVIGLSPDSATKHARF
    RTKHALTVDLVADEDRVALEAYGVWVEKSMYGRKYMGVERTTFLIGADGRIAQVWNKVKVDGHAQAVLEAARRL

    >gi|161618895|ref|YP_001592782.1| FeS assembly scaffold SufA [Brucella canis ATCC 23365]
    MQQRCYNTNYSENVAKVVLSRLPHSRLDDSPAICQPVPEEFEMGRFAVITLTDAAANRVHEIMTSREDALGIRVGVKKGG
    CAGMEYTIELVTEAKAGDDLIEKDGAKVFIAPEAVLFLLGTQMDFEVTTLRTGFVFNNPNQTSACGCGESVELKPASPES
    LR

    >gi|161618943|ref|YP_001592830.1| arsenate reductase [Brucella canis ATCC 23365]
    MDVTIYHNPVCGTSRKVLGMIREAGIEPHVIEYMKTPLPRDMLVELLRQMAISPRALLQAKEARYAELGLDDPALSDEVL
    IDAMISNPVLMNRPVVVTPKGVRLCRPAETVQELL

    >gi|161618964|ref|YP_001592851.1| glutathione reductase [Brucella canis ATCC 23365]
    MTGFDYDLFVIGGGSGGVRAGRLAGAIGKKVGLAEEYRMGGTCVIRGCVPKKLFVYASQFPEHFEDSAGYGWSMGEAAFD
    WKKLIAAKDKEISRLEGLYRKGLENSHVDIFASRAELIDEHTIELKADGRRVTADKILIATGGRPNTHESLPGHEY
    CISS
    NEAFHLEELPKSIVIAGGGYIAVEFANIFHGLGVETTLVYRGKEILSRFDHDIRSLLHETMEAKGIRILCGAIFEKVEKK
    ADGKLSVELSNGETLETDQAMLALGRIPNTDGLGLEKAGVKIDKSGAIEVDDYSRTNVENIWAVGDVSNRVQLTPVAIHE
    AMCFLETAFKDNPTKPDHELIATAVFSQPEIGTVGLSEDEAAKKYPELEIYRALFRPMKNTLSGRSEKTLMKLVVESKSR
    KVLGAHIMGPDAGEMAQLLGISLKAGATKDDFDRTMAVHPTATEELVTMYKPTYRVVDGKKIEG

    >gi|161619005|ref|YP_001592892.1| 3-mercaptopyruvate sulfurtransferase [Brucella canis ATCC 23365]
    MTEKSAFVVSRDWLKERLHKPGLAIVDASWYLPAAGRNGQEEYEKAHIPGAVFFDQDKIADKESGLPHTLPSPEFFAQQV
    GTLGITADETVVVYDGPGMFSAPRVWWMFRVMGVKNVYVLDGGFDGWKKAGYPVTDEVTKIAATFFKPSFNKDAVVDFQE
    MRKIVDEKRSQIADARGAGRFTGRDAEPRAEMRSGHMPGARNVPVTTLSENGELKDLESLRRIFDEAGIDLSGPVVTS
    CG
    SGVTAAVITLALTSLGHKDNRLYDGSWSEWGSRQDTPVVTGEAE

    >gi|161619078|ref|YP_001592965.1| dihydrolipoamide dehydrogenase [Brucella canis ATCC 23365]
    MADIYDVIVIGSGPGGYVTAIRAAQLGLKTAIVEREHLGGICLNWGCIPTKALLRSAEILHFGEHAKDYGLKLDGTITPD
    VKAVVQRSRGVSARLNGGVAFLMKKNKIDVIWGEAKLVKAASGSNPAEISVGKTSKQPMQPQNPVPKGVLGEGSYKAKHI
    IVATGARPRALPGIEPDGKLIWTYFEAMVPQALPKSMLVMGSGAIGIEFASFYHDMGVDVTVVEVMSQIMPVEDAEISAI
    ARKQLEKRGLKIIIDAKVAKVEKGANSVTAHVETKDGKTQTLTVDRMISAVGVQGNIENLGLEALGVKTDRGCIVIDGYG
    KTNVAGIYAIGDVAGPPMLAHKAEHEGVICVEKIAGLPNVHPLDKGKIPGCTYCNPQVASVGLTEAKAKEQGYDIRVGRY
    SFSANGKAIALGEDQGLVKTIFDRKTGQLLGAHMVGAEVTELIQGFVIAMNLETTEEELMHSVFPHPTLSETMKESVLDA
    YGRVLNA

    >gi|161619446|ref|YP_001593333.1| thioredoxin-disulfide reductase [Brucella canis ATCC 23365]
    MTQRHAPVIVIGSGPAGYTAAIYAARAMLKPVVIAGLQQGGQLMITTDVENYPGYAEPVQGPWMMEQMARQAENVGAQIV
    HDIITEVETTVRPFRLKGDSGTIYTCDALIIATGAQAKWLGLESEQTFMGGGVSA
    CATCDGFFYRGKDVVVVGGGNTAVE
    EALYLSHIAKSVTIVHRRDGFRAEKIMQDRLLSRENVSVVWNSVIDEILGTEARPPMGATVTGVRLKNIVTGETQERATH
    GVFIAIGHAPAVSLFEGKLKQKPNGYLWTAPDSTATDVPGIFAAGDVTDDIYRQAVTAAGMGCMAALEAERWLAAQEPLH
    EAAE

    >gi|161619579|ref|YP_001593466.1| disulfide bond formation protein B [Brucella canis ATCC 23365]
    MASLTQPAGKIQVWTAGIMTIGLAVTVGIALAFEHIGGYMPCKLCLEERIPYYIGIPVLAVAWIACMAKWPPVLTRGLIL
    VGALLMTIGLALSIYHTGVELKYWPGPID
    CSAATMKITRDAGNLLNDLNTHPPACDSAPGYFLGLSFAGWNAVASLLFAA
    ISYYGAFAKSGK

    >gi|161619794|ref|YP_001593681.1| glutaredoxin 3 [Brucella canis ATCC 23365]
    MVDVIIYTRPGCPYCARAKALLARKGAEFNEIDASATPELRAEMQERSGRNTFPQIFIGSVHVGGCDDLYALEDEGKLES
    LLKTGKLI

    >gi|161619836|ref|YP_001593723.1| dihydrolipoamide dehydrogenase [Brucella canis ATCC 23365]
    MSYDVVVIGTGPGGYVAAIKAAQLGLKVAVVEKRKTFGGTCLNIGCIPSKALLHASEVFAEAGHSFDTLGVEVTPKLNLT
    KMLAHKDTTVKANVSGVEFLFKKNKITPYIGTGKIVGKGKVSVTSEDGKVEEIEAKNIIIATGSDVAGIPGVKVDIDEKV
    IVSSTGALSFDKVPGSLIVVGGGVIGLELGSVWARLGAKVTVVEYLDKVLGPMDGEVSKQFQRLLEKQGIAFKLGAKVTG
    VEKVGKGAKVTFEPVKGGDAETLEADAVLIATGRRPYTDGLGLQEAGVAVDERGRVAIDDHWRTNVEGIYAIGDVVQGPM
    LAHKAEDEGIAVAEIIAGQAGHVNFDVIPSVVYTQPEVASVGKTEEELKAAGIDYKVGKFPFTANGRARAMLHTDGFVKI
    LADKATDRVLGAHILGYNAGEMIHELAVLMKFGGSSEDLARTCHAHPTMSETVRESALATFAKPIHM

    >gi|161619898|ref|YP_001593785.1| redoxin domain-containing protein [Brucella canis ATCC 23365]
    MAEDNEKATSEQNAKSGNRKIVLLAALAGVIAGIGAVYVMERPSGNVVDQNVSANLAAESDAASAQCALKADALKALDAA
    ATGGVAAMRAAEKPISLAHIAFTGPDGKKMTLGDYKGKTLLVNLWATW
    CAPCREEMPALDKLQGEKGGNDFDVVAINIDT
    GSDDKPKGFLSEIGIKNLTLHRDASMASFNELKRKNLAFGLPVTLLVDKDGCQIAAMNGPAPWDSPDAIKLIDAAKNL

    >gi|161619934|ref|YP_001593821.1| heavy metal translocating P-type ATPase [Brucella canis ATCC 23365]
    MNQISFRVDGMDCASCAAKIDTAVRRVKGVEDVSVSVTAGTMTVRHDGSGDIETMARKVRSLGYGVEQLAKERQAAVHDH
    HHDHGDCDGHHHDHDHHHDHAHAESPLEAAPNSLRFRVDGMD
    CASCAAKIDTAVRRLAGVTDVSVSVTNGTMTVNQDGSA
    DSNEIAAKVTALGYRTVLAENGSGAAQPAAPAGSLSWWQTKKGRTMLACGGGLLAAYAIGHLYPAVMHWAFMAAMLIGLV
    PIAWRACMAAVNGTPFSIEMLMTVAAVGAIIIGATEEAATVVFLFLVGELLEGVAAGKARASIQSLATLVPKTAFLERNG
    TTREVAAESLSIGDVISVRPGDRMPADGEIISGESAIDEAPVTGESTPVGKGEGDVVFAGTINGDGLLRVKVTAAAQDNT
    IARVVRLVEEAQEAKAPTERFINRFSTYYTPGVVVVAALVAILPPLFAGGVWDEWIYKGLAILLIGCPCALVISTPAAIA
    AALSSGARRGLIMKGGGVLETVGKITTACFDKTGTLTEGKPKVTDVLAGALPEDEVLRLAASLDAGSSHPLALAIVSAAE
    ERALKLAEITQGKAHGGKGVSGVAGKSVLFLGSRKAANDIAAIPDALAGRIAACNDEGKTVSVLVADGRIAGAIAMRDEP
    RADAIAGLKKLKDGGIATLMLTGDNRRTAEAIGRDLGIEVRAELLPEDKQRIVGELRKEGRIVAKVGDGINDAPALAAAD
    VGIAMGGGTDVALETADAAILHGHVSDIAEMVDLSKRTMRNIHQNIGIALGLKAVFLVTTVLGITGLWPAILADTGATVL
    VTVNALRLLRQPVR

    >gi|161619977|ref|YP_001593864.1| spermatogenesis-associated protein 20 precursor [Brucella canis ATCC 23365]
    MTEPDSNRLAGEPSAYLRQHANNPVHWQPWGRKALDAAKELDRPILLSIGYAACHWCHVMAHESFEDDDVAAVMNAFFIN
    VKVDREERPDIDQIYMAALGAMGQQGGWPLTMFLRPDGKPFWGGTYFPRHARHNMPGFVDILHAVNNLWHRDKDKINHNA
    EAVFDHLEGRLAAQSQPLQNEISRFDDLANRIGSLIDPQRGGIEGVPKFPNAPFMDTLWLSWLYRHNETHRDNFLLSLKT
    MLQGGIYDHLGGGLCRYSTDAEWLVPHFEKMLYDNAQFIRHANYAFAETGDDLFRIRIEETVDWLIREMQLPDGCFASSL
    DADSEGEEGKFYVWTEDEIDAVLGTYAEVFKTFYAVTPGGNWEGKNILNRLHAAAETPTPPPLVEAARRKLLAHRETRIR
    PGRDDKALTDWNGLAIRALAEAGRSFARTDWLEHAVQAYRSIGSSFQDGRIAHCRMEGAFLYPALATDYAAMINAALALY
    EATGEFAYIDDARKFKRALDGSHRDSAGNYRLSALGADDVILHAYGDYDEAIPSATSQIIEALTRLFLATGDSALYEENE
    KLIEQALGRALAQQYGQIGILNACRFAGEPLSLVIAATDRTDELVSIANRTLDPRRLDKFVLVERGKTMSLPTGGTIEPE
    HPAAWFCKGHVCLPPVDTGEALRSLL

    >gi|161620016|ref|YP_001593903.1| thioredoxin [Brucella canis ATCC 23365]
    MATVKVDNSNFQSDVLQSSEPVVVDFWAEWCGPCKTIAPALDEIAAEMAGQVKIAKVNIDENPELAAQFGVRSIPTLLMF
    KDGELAANMVGAAPKSRLADWIKASAA

    >gi|161620174|ref|YP_001594060.1| rhodanese family protein [Brucella canis ATCC 23365]
    MSNLPFTVAALYCFAPLPQYESLREPLAQLCCANGIKGTLLLAAEGINGTVAGSAGAIEKLIAHITAIPGLGEPELKYSH
    ASEMPFHRMKVRLKREIVTMGVEGIDPLKSVGTYIAPKDWNALIADENTVVVDTRNDYEYAIGTFEGAIDPQTRTFREFP
    EWVKQNRDRLEGKKIAMFCTGGIRCEKATAFVKGLGFDDVYHLKGGILKYLEEVPREQSVWNGECFVFDERVAVGHGLAE
    SDVELCRACRRPLTPQDKLSQFFEEGVSCAGCYAERTPEDRARYAERQKQVKLAEKRGANKHIGS

    >gi|161620387|ref|YP_001594273.1| glutaredoxin-like protein NrdH [Brucella canis ATCC 23365]
    MNVTVYSKPACVQCTATTRALDRQGIDYKVIDISADANAFDLVQGMGYRQVPVVVAGENHWAGFRPDMISSLA

    >gi|161620514|ref|YP_001594400.1| methionine sulfoxide reductase B [Brucella canis ATCC 23365]
    MKYQKSAEAIAKLSAEQYRVTQENGTERPGTGEYLYNKEPGIYVDIVSGEPLFASSDKYESHCGWPSFTKPIERANVTEL
    TDMSHGMVRTEVRSAHGDSHLGHVFPDGPVDRGGLRY
    CINSASLRFVPKDRMEAEGYGDYLDQVEG

    >gi|161620525|ref|YP_001594411.1| protein of unknown function DUF395 YeeE/YedE [Brucella canis ATCC 23365]
    MMALYMQALLGGMLIGLSAVLLLLLNGRVAGISGIVGRLLDGKQISGNLLFIIGLLMGPVVYAWIFGAFPATDIAASWPV
    ILIAGLLVGVGTRMGSG
    CTSGHGIVGLARFSRRSLVATIVFLIAGVIAASLAGAFL

    >gi|161620589|ref|YP_001594475.1| dihydrolipoamide dehydrogenase [Brucella canis ATCC 23365]
    MSEISCKLLIIGGGPGGYVCGIRAGQLGIDTVLVEKTRLGGTCLNVGCIPSKALIHAADEFHRLTTFAAKSPLGITTQNP
    AIDFARTLEWKDGIVHRLNSGVAGLLKRSRVRMFQGQARFQDGKTVLVDTDTGRQTIHAENIVIATGSVPVEIQALPFGG
    NIISSTEALSLEKIPERLAVVGGGYIGLEIGTAFAKLGSRVTVVEATDRILPQYDAELTRPVMARLKTLGVEVLTGTSAK
    GLSADGKALEIRTQDGAVKAIEADKILVTVGRKPQTDGWGLSEIRLDMDGRFIRIDDRCRTSMRGIYAIGDVTGEPMLTH
    RAMAQGEMVAEIIAGGKHAWDKRCIPAVCFTDPEIVTVGLSPDEARKAGHNIQTGLFPFQANGRAMTMERDDGIVRVVAR
    ADNHVILGIQAVGAGISELSAAFAQAVEMGARLEDIAATIHAHPTLGEGFAEASMKALGHALHV

    >gi|161620639|ref|YP_001594525.1| DSBA oxidoreductase [Brucella canis ATCC 23365]
    MTGKKITIDVVSDVVCPWCFLGRKRLEAALASLPDVEAEIRWRPFQLDPTLPPHGKDRQTYLREKFGTGSKIDDSHRQLR
    ALGEEYGIVFDFDAIIRAPNTLDAHRVIHWAAQAAPDTQDRMVGMLFSLYFEQGQDIGNHEVLVDAAASVSMDAEVVARL
    LQSEADKDTIRDEIATANRIGVRGVPCFIIDQKYAVMGAQTPDVLADAIRQTAEGFEPGIAEDR

    >gi|161620767|ref|YP_001594653.1| thioredoxin peroxidase 2 [Brucella canis ATCC 23365]
    MLGIGDKLPSFKVTGVKPGFNHHEENGVSAFEEVTEQSFPGKWKVIFFYPKDFTFVCPTEIAEFARLASEFEDRDAVVLG
    GSTDNEFVKLAWRRDHKDLNKLPIWSFADTNGSLVDGLGVRSPDGVAYRYTFVVDPDNVIQHVYATNLNVGRAPKDTLRV
    LDALQTDELCPCNREVGGETLKAA

    >gi|161620938|ref|YP_001594824.1| OsmC family protein [Brucella canis ATCC 23365]
    MPILYTTQSTATGGRTGSAKTADGRLSVVLDTPKELGGQGGEGTNPEQLFASGYAACFLGALKFAAAKEKISIPAESTVT
    ATVGIGPREDGTGFGLDVALSIALPGIDKAKAEELVQAAHIV
    CPYSHATRGNLDVRLSVA

    >gi|161620942|ref|YP_001594828.1| methylated-DNA-[protein]-cysteine S-methyltransferase [Brucella canis ATCC 23365]
    MLFTLPNQDKLYDALVARDASYEGRAYVGVLSTGIFCRLTCPARKPKPENCRFFASVAECMADGFRPCKRCHSLQPAAEA
    EILVKKLLNALETDPERRWSEEDVVRMGFDPSTVRRSFRRHFGMTFLEMARQERLRHSFQVLAGGGRVIDAQVDAGFESP
    EAFRSAFARIVGLPPAKLRKEGLLRADWFKTPLGTMIAICDVRSLHLLEFADRKALPAELKKLHAACRGDIGIGRFETHD
    LVERQLNAFFEGRSAVFDLPLVMHGSPFTQDVWRELQNIRAGETRSCSEIARAIEKPLAVRAVARANGANQIAIVIP
    CHR
    VIGADGALTGYGGGLWRKQKLIEIEAQYRR

    >gi|161620946|ref|YP_001594832.1| thioredoxin [Brucella canis ATCC 23365]
    MTSQDNPYGGAYGGPVSQMTANVSFGQPSAPANGGDLIKDTTTAGFQADVITESRKQPVLVDFWAPWCGPCKQLTPIIEK
    AVREARGAVKLVKMNIDEHPAIAGQLGIQSIPAVIAFVNGQTVDGFMGAQPETKVKEFIAKVGGPSDQEAALAEAIATAK
    ELAQAGDFVQAAEIFSSILQVAPDNVDAVVGLATCMLESGDAEQARSLLGTLAAEKQNEAPVRALEARLALADQVKLIGD
    PVELERRLAADPGDYQARFDLAQVRNAQGRRDDAANELLAIMRADRAWNDDGARKQLLQFFEAWGHMDPATLTARRKLSS
    LLFS

    >gi|161621050|ref|YP_001594936.1| glutathione S-transferase [Brucella canis ATCC 23365]
    MKLYYKAGACSLASHIILEEAGLAYTLEAVDLKAKKTASGADYLAINPRGAVPALEVEPGVVITQNAAILQYIGDHSHVA
    AFKPAYGSLERARLQEALGFCSDLHGAFGGLFAPNLSEEARPGIIANINRRLGQLEAMLADEHSYWLGAEFTQADAYAAV
    ILGWGVGMKLDLNAYPKALRLYERVLARPNVQKAMKEEGLI

    >gi|161621085|ref|YP_001594971.1| SelT/selW/selH domain-containing protein [Brucella canis ATCC 23365]
    MSAHPRISITYCTQCNWLLRAAWMAQELLQTFGQDLAEVALRPGTGGVFEIRVQMPDGSEELIWERKRDGGFPEAKVLKQ
    RVRDLVWPERDLGHSDRPISS

    >gi|161621117|ref|YP_001595003.1| methionine sulfoxide reductase A [Brucella canis ATCC 23365]
    MSFFDSYRKKMQMPSKEEVLPGRVQPIPTAAAHFVSGHPLKGPWPDGMKQVLFGMGCFWGAERLFWQVPGVYVTAVGYAG
    GITPNPTYEETCTGLTGHAEVVLVVYDPKVVTLNELLALFWEEHDPTQGMRQGNDIGTTYRSVIYTFNAVDRAVAEKSRD
    AYSQALASRGLGPVTTQIADAPDFYYAEDYHQQYLAKNPDGYCGLRGTGVSCPIPLAH