Brevibacillus brevis NBRC 100599 uid59175

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|226309637|ref|YP_002769531.1| hypothetical protein BBR47_00500 [Brevibacillus brevis NBRC 100599]
    MSVQSNFSADKTLDCKGLACPMPVVRTKKAMEEMLPGQVMEVQATDKGSLADLKSWANNTGHEYLGSIQEGEVWKHFLRK
    ASTHEVKEETNFLRTISNEELQKKLEANEKLTLIDVREQAEYAFHRIPVAISIPLGVLEQRLDELQLDDDIYMI
    CRSGKR
    SDMACQLLAKKGFTKITNVLPGMSGWNGPVEKQ

    >gi|226309638|ref|YP_002769532.1| hypothetical protein BBR47_00510 [Brevibacillus brevis NBRC 100599]
    MMEQQTSVKVMTAHELTQLLFAQEELFILDVRNTSDYENWRIEGHRVVSMNIPYFDLLDGVESVLEKIPVHQKVLVVCAK
    EGSSIFVAEMLAEAGFTDVSYLQGGMKAWSDHLEPVKVGELRDGGAIYQFVRIGKGCLSYMIVSGGEAAVVDTLRMTDVY
    EAFAAKHQWTIKHTIDTHLHADHISGGKKLAERLDASYWLPEKDAEEVTYFYRKLEEGQEIQVGATKIAILPIYSPGHTI
    GSTSLLVDDTYFLTGDSLFVASIGRPDLAGKAEDWVGDLHNTLYNRYKELPEHLVVLPAHFGSYTEIGPMGVVSARLGDL
    YRNNPGLTIADESEFRHIVTHHLPPQPNAYQEIRQVNMGKLKPSEEEQQEMEVGPNRCAIHDK

    >gi|226309643|ref|YP_002769537.1| hypothetical protein BBR47_00560 [Brevibacillus brevis NBRC 100599]
    MSFTTILLLFAYAVIIWYLISRFLPVKGLENLKSDQFKERVNQKSRVLLIDVREPHEYKAGHIPSAVNIPLSALDQRAKE
    ISSKNDILLY
    CRSGMRSKRAAKILKKHGVSQMAHLQGGFITWSGPKKKK

    >gi|226309859|ref|YP_002769753.1| hypothetical protein BBR47_02720 [Brevibacillus brevis NBRC 100599]
    MKTYLSPANLQRIPELIKLSPEAAASYLDFEHQVYQTANTLPQKTKELLAVTVAHVTGCPYCIDVHVKKYKALGGTMEEI
    MEALLVAASTRAGAILSHGVNALISYEEGEENAPQKGSNEGIKCFC

    >gi|226309891|ref|YP_002769785.1| hypothetical protein BBR47_03040 [Brevibacillus brevis NBRC 100599]
    MEHYLAEQYREGLQAFGQLMPEALRAYNEFTSQCFSSGELSSKHKHLQALAISLYSGNEHCIVYHLEAALNDGVSQKEIA
    ETVAVAGAFGGGTTLSHGVILINDVMEEKQGTIQ

    >gi|226309923|ref|YP_002769817.1| probable heavy metal-transporting ATPase [Brevibacillus brevis NBRC 100599]
    MDCSSCAKSLEKHMHTLPAVKEVNVNFSTGKMQLVADGLGEDAVVKEVAKAGYSAMLLTRRTAKAVPKTDQAGTTLTVIS
    GVLLALGFLGSLSSGIPPLVVTVLYALSIISGGYRPARSAFYAIKSGSLDMNVLMSVAAVGAALIGEWLEGATVVWLFSI
    GNLLQTKSIEKTRDSIRNLMDLAPPEAWVKVGESLTRKPVEDITVGQVIVVKPGEKIPLDGVIVHGTSSVNQAPITGESI
    PVDKLVGDSVFAGSVNESGAVEIKVTKLVEDTAIARIIHLVEEAQEKKAPTQAFVDKFATIYTPIVLVLALLVIVFPPLL
    GLGTWGEWFYRGLELLVVACPCALVISTPVAIVSAIGNAARNGVLIKGGTFLEKAGAITAIAFDKTGTLTEGKPQVAAVI
    EMEGSEDDVVSIARTIEERSSHPIALAILTYAKQKQIASQSGQDFKAIVGKGASAVIGTETFYAGKPALFQELGVDLSAW
    QTKVESLQSEGHTLVVIGTATKLIGMIAVADTIREITVSAIGKLKAAGIEDIVMLTGDNTGTAKKVASQTGVNRYFAELL
    PQDKVEAVKRLQQEGKVVAMVGDGINDAPALASADLGIAMAGAGTDTAMETADIVLMADNLEKLPHTMKISRKALTIIKQ
    NIWFSIIVKLIALVLIFPGYLTLWLAVLSDTGAALLVILNSMRLLRMKG

    >gi|226309961|ref|YP_002769855.1| copper-transporting P-type ATPase [Brevibacillus brevis NBRC 100599]
    MSAKTAEATVAISGMTCAACALRIEKGLGKMEGVETANVNLALEKSTVVFDPTKTNIDDIRSKIESLGYGVVSDKVELNI
    SGMT
    CAACSTRIEKGLNKTAGVLKANVNLAMETATVEYDSSQVSVTDLIQKVEKLGYQATRKEDGKEEEKVDRRQEEIKR
    QTRKFWISAILSLPLLWSMVSHFSFTSFIWLPESLMNPWVQLALATPVQFIIGAQFYVGAFKALRNKSANMDVLVALGTS
    AAYFYSLWVAINSIGAHGGHMLELYFETSAVLITLIVLGKLFEMKAKGRSSEAIRKLMGLQAKTAVVVRDGVEMTIPVEE
    VRLGDVVHVKPGDKVPVDGIVMEGQSAVDESMLTGESIPVDKAAGDTVIGATLNKNGFLKVQATKVGKETALAQIIKVVE
    EAQGTKAPIQRVADSISGIFVPIVVGIAILTFLIWYFFVIPGNFGEALEKAIAVLVIACPCALGLATPTSIMAGSGRAAE
    LGILFKGGEHLETAHHLDTIVLDKTGTVTKGEPELTDVIAIDIEEQELLSLVGAAEKNSEHPLAQAIVRGIADKGITVAD
    TGSFEAIPGFGIRATVSGKEVLVGTRRLLEKHQISYQAVSDTMLALERSGKTAMLAVVEGKLAGLIAVADTIKPTSKQAV
    QRMKAMGLTVIMMTGDNRQTAEAIAREAGIDHVIAEVLPEGKAAEVKKLQEQGKKVAMVGDGINDAPALATADVGMAIGT
    GTDVAMEAADITLMRGELTSVADAIEMSKLTIRNIKQNLFWALAYNTLGIPIAAIGLLAPWLAGAAMAFSSVSVVLNALR
    LQRVKL

    >gi|226310036|ref|YP_002769930.1| hypothetical protein BBR47_04490 [Brevibacillus brevis NBRC 100599]
    MSHGVKEMTPQELLEKLEAKEELQVIDVREVDEWNAGHIKEAKLIPLGFLPHRIDELDKNIPIVMVCRSGARSNTATEYL
    SAQGYDVANMVGGMLAWPGEVEQ

    >gi|226310037|ref|YP_002769931.1| hypothetical protein BBR47_04500 [Brevibacillus brevis NBRC 100599]
    MGQAGRKQPMSEGAQLQQESAMKKHWFPVLAGIIILAIVGVFGYNYMTKEKIEVLKPIADFTLDNSDGTTYTFHSSAGKV
    RLVEFMFTK
    CPDICPATTFNMAKLQDQLKEKGLFGDKVEFVSISFDPDNDTPEVLQDYAAKFKADQSGWKFLRGDAQAVE
    KVTKDFGLMVIKQPDGSYAHTARMFLVDGDGNMRRAYGMAANMELEVMMKEMVQLAD

    >gi|226310078|ref|YP_002769972.1| hypothetical protein BBR47_04910 [Brevibacillus brevis NBRC 100599]
    MAHKVIIYTQVTCGPCQEEKMWLTSNNIAFEDRDIRQNEAFFQEAIQLGASMTPVTYIEKENGEQIVIHGFDKEELKKAL
    DLN

    >gi|226310153|ref|YP_002770047.1| hypothetical protein BBR47_05660 [Brevibacillus brevis NBRC 100599]
    MQEYVELTELLTDIEGHPLSLLFIKTANCGVCDVTYVRTVELLKQYPQVKSMVASMEKMPNLSGEFLVFTAPAILLFMDG
    KEVFRQARFVSFDKLENVLKLTVDAT

    >gi|226310550|ref|YP_002770444.1| hypothetical protein BBR47_09630 [Brevibacillus brevis NBRC 100599]
    MKIEIWSDFACPFCYIGKRRLEGALSQFPHKDQVEVVYRSFQLDPQMERDTDMDMHEVLAAKYSIPLEQAKGMNDQVTQM
    AKGVGLDYHFDTMIPTNTFDAHRLTHFAHAHGKMKEMKERMLKAYFTESLHLGDHEVLAQLASEVGLDKEATLAMLAGDE
    YREQVQEDKQRGNDLGVTGVPFFVINNKYAVSGAQPGEVFLGALNQVWEEESATPALKFVQNDEKKDEQSGDNCADGSCK
    I

    >gi|226310609|ref|YP_002770503.1| hypothetical protein BBR47_10220 [Brevibacillus brevis NBRC 100599]
    MQARINHRAVNPEAYQTMLKLEKFVNESGLDKKLIELIKIRASQINGCAFCMDMHTQDARKLGETEQRIYLLSVWRESAV
    YTEAERAVLALTEAVTVITANGVSEELYQQVREHFDENQYVSLIMAINTINCWNRIAISTGMSAPYNK

    >gi|226310626|ref|YP_002770520.1| hypothetical protein BBR47_10390 [Brevibacillus brevis NBRC 100599]
    METFIQWSVIALWVFVIVQFVVIYLLTKLVADFINKLQAKEKEPSVDNWIGSRAPVLIDNSPSGTSIEFTEMKSHSTLVL
    FTAEG
    CPICQQIIPHLEKVKLRFPQLKLLVVYSGKLTHETQNQDDIQYIDSTISFSMYQIDAMPSAVLIDKKGIILAKET
    VPTIHYLLALLEKHVPIEADTSEFTPTSLSTNPGENKANKIAPQPYS

    >gi|226310648|ref|YP_002770542.1| probable thiol peroxidase [Brevibacillus brevis NBRC 100599]
    MTAVGQAAPAFTLQASDNQTLSLSQFYGQNVVLYFYPKDQTPTCTTEACDFRDFHSGFAELNTVVLGISPDSVKSHDKFI
    AKHELPFPLLADPDHQVAEAYGVWVLKKMYGREYMGIERTTFVIDKEGNIAKVWPKVKVKGHVQEVLQFIKEELQS

    >gi|226310662|ref|YP_002770556.1| probable methylated-DNA--protein-cysteine methyltransferase [Brevibacillus brevis NBRC 100599]
    MAKELGYTMMDSPIGPLLLASTEEGLCYIQFANEQDGLAPLVRWCKKTFVGITPTRNDAINEPAKIQLEEYFAGKRKTFD
    VPTVLYGTPFQKSVWNELSNIPYGETRSYKDIALAIGAAKAVRAIGGANNRNPIPVIIP
    CHRVIGSNGALVGYGGGLSIK
    EYLLSLEEGPLFAHASS

    >gi|226310816|ref|YP_002770710.1| hypothetical protein BBR47_12290 [Brevibacillus brevis NBRC 100599]
    MTARIGLPAPDFTMDTVTFDNGFPLPKSLVDYRGKWLLLFFYPFDFSKVCPTEILSLNRRIKEFTDLNVEVLGISGDSIH
    THKAWMRASEGIGPLSFPLASDYSKEATMAYGVLDEATKAPLRGSFIIDPEGILQYAVISNSKVGRSVDETLRVIEALQS
    GGLCPMDWKPGQNTIS

    >gi|226310848|ref|YP_002770742.1| putative thiol-disulfide oxidoreductase [Brevibacillus brevis NBRC 100599]
    MKKHHNVWAIVVLLGLLGWGIFDAEILNKQEPSASSGEQGNGQIGMEKGNTAPDFELQQLGGGTVKLSNFRGKKVILNLW
    ATW
    CPPCRAEIPDMQRYYEENKEKGVVILGVNLTDTETSPEVVADFVKLYGISFPILLDPDKKVANVSKAISIPTSYIID
    SNGVVQNKYIGPMSEEIMENMLSAIQ

    >gi|226310937|ref|YP_002770831.1| probable thioredoxin reductase [Brevibacillus brevis NBRC 100599]
    MYDVIIIGGGPAGASAAIYTARGNLKTLVIDKAPGAGALALTHKIANYPGVEGEMTGKELLDKMRRQAEGFGAEFIQTTI
    SAVDVEDEEKSIFTAHGTFQAKAVIVATGSKGRNRMLPGEEQLLGRGVST
    CATCDGAFYEGKHVAVIGDTEEALEEAHAL
    TKFTDKITFLVPRADLQGVDELPRLPNTEIHFRTRPLEIVGEKSVEGLRIRTAEGTEEMLSVDGVFVFLSGSKPGTDFLD
    GQVPLDEEGFMILDEFMQSSVPGVFGAGEVRKTPVKQAVVAAADGAIAAMAVDKYINKRSKVVPQYK

    >gi|226310938|ref|YP_002770832.1| hypothetical protein BBR47_13510 [Brevibacillus brevis NBRC 100599]
    MAQAIVYSSTHCNFCQQLKSYLTEQNISFEERNIDEKEEYFQELSRLGVMSVPLTVIGEKQILGFNPTRIKKALAVLEEA
    AK

    >gi|226310939|ref|YP_002770833.1| putative peroxiredoxin [Brevibacillus brevis NBRC 100599]
    MTTMTTQQTVQLQVGKPAPDFNMLTTKNLETLEERVSLADYKGKWLILFFWPFDFTFVCPTEVTSFSDNMEEFEELDCEV
    LGVSTDSVHTHRAWIKTPRDENGIGEVNFPLASDFKKETAQAYGVLDEETGAAHRGLFIIDPDGILRYQVVTDMNVGRSV
    TETTRILQALQAGGLCPANWKPGQKTL

    >gi|226310940|ref|YP_002770834.1| putative disulfide oxidoreductase [Brevibacillus brevis NBRC 100599]
    MNQLIDVGIIGGGPAGMSAALALGRARKRVVVIDEGRPRNRVTRESHGFLTRDGITPSEFRRIAREQISAYPSVHFVEDT
    AVTITGHDGNFLIMTAQGTTYQSKKLLFAVGMKDLPLPVNGLAEVYGKSAFV
    CPYCDGWELRDQPLVLIANGEKALHLAK
    VLSGWTNHYTLCTNGPDEFTEEQRMELLQHRIPVFDSPIERIVSIDGMVQHVELTDGNSISCTGIFFAPKLVAASDLPQA
    LGCQVTEAGTIIVDNFGKTSVPGVYSAGDAATTQYQVITAAALGSAAGMSINNELLVEAWNRQS

    >gi|226311081|ref|YP_002770975.1| NADH dehydrogenase/alkyl hydroperoxide reductase [Brevibacillus brevis NBRC 100599]
    MALDQEIKAQLEQYLELLEGDIVLKVSAGTDEASSEMLALIDELASMSLKISVEKAELTRTPSFSVNRVGEDTGVVFAGT
    PLGHEFTSLVLALLQVSGRAPKVEQSVIDQIKDLRGEYKFESYISLS
    CHNCPDVVQALNLMSIFNPGITHTMIDGAVFKD
    EVESKNVMAVPSVFLNGEFFESGRMTVEEILAKLGSAPDASEFDNKDPYDVLVVGGGPAGASAAIYAARKGIRTGLVAER
    LGGQVNDTLGIENFISVKYIEGPQLAANLEKQVKEYGIDVMKLQRAKRLEKKDLIEVELENGAVLKSKTVILSTGARWRN
    LGVPGEAEFKNKGVAY
    CPHCDGPLFIGKDVAVVGGGNSGVEAAIDLAGIVKHVTVLEFSPELKADAVLQDRLYSLPNVTV
    LKNVQTKEITGTDKVNGISYIERETGETKHIELQGVFVQIGLVPNTDWLGETIERTRFGEIVVDSHGSTNIPGVFAAGDC
    TNSAYKQIIISMGSGATAALGAFDYLIRN

    >gi|226311082|ref|YP_002770976.1| alkyl hydroperoxide reductase subunit C [Brevibacillus brevis NBRC 100599]
    MSLIGTEVLPFKAQAFQKGKFLEVTEANFKGQWSVVCFYPADFTFVCPTELEDLQNQYATLKELGVEVYSVSTDTHFTHK
    AWHASSEAISKVEYIMIGDPSHVISRNFDVLIEAEGLADRGTFIIDPDGVIQAVEITAGGIGRDASALINKIKAAQYVRN
    NPGEVCPAKWQEGGKTLKPSLDLVGKI

    >gi|226311260|ref|YP_002771154.1| thioredoxin [Brevibacillus brevis NBRC 100599]
    MAIVNATDQNFSQEVEQGGTVLVDFWAPWCGPCKMIAPVLEQIDGEVGSQLKIVKVNVDDNPDSAGRFGVMSIPTLIVFK
    DGQPVDKVIGFQPKEALMATVGKHL

    >gi|226311551|ref|YP_002771445.1| protein disulfide oxidoreductase [Brevibacillus brevis NBRC 100599]
    MKKVIALSILVAALLIGAIVYADISNRQLAEGNPYGKANLHPATLEQLSDPLYDNLIMPNELKGKLDNQEDAFVYFYSPV
    CEHCKATTPVLVPIVKSLDIDMKKLNLLEFNASYGEYNIEFTPTLVHYKGGKEVARLVGGREASEWKTWLEEQKKS

    >gi|226311568|ref|YP_002771462.1| putative bacterioferritin comigratory protein [Brevibacillus brevis NBRC 100599]
    MLKVGDSAPVFTATSTKGTIDLRNHIGKENIVLIFYPGDDTPICTKQLCAVQDHYKKIEQANTLVFGVNPGGMDKKRSFA
    DKFRYEFPLIVDEDESIRKAYDVGKVLGLFFQQRIVYIIGNNGTIIYAKKGNPPVSELLQVIENQA

    >gi|226311753|ref|YP_002771647.1| hypothetical protein BBR47_21660 [Brevibacillus brevis NBRC 100599]
    MITITPIAAVRLAQMIAEESDAEQLGIRLVPTTTGCGSYTYSIAITEADKHDHAREISGIRFFYQTHEIDQLSGTVIDCD
    PATGRFSIFHPRPMQTDCSLTH

    >gi|226311807|ref|YP_002771701.1| putative 3-mercaptopyruvate sulfurtransferase [Brevibacillus brevis NBRC 100599]
    MQALVTPQWLKDHLNDENLVIVDCRFALSASEAGAEEYKNDHIPGALYFHLNRDLSGSKSEHGGRHPLPDTDLLAAHFSN
    AGIDANTTVIAYDDQEMAMAGRLWWLLRYLGHDRVAVLDGGYAAWKKAGYEVTAEVPTVQARQFVPHVRHDMLVDMEGVK
    KRSEHTVLLDSRAPERYRGENEPIDAKAGHIPGAHNFFYKDNLGADQTMLPTDELQKRLAPYADKELIVY
    CGSGVTACSN
    LLAFHAAGRTNVKLYLGSWSDWSSYPDNPVATGEE

    >gi|226311856|ref|YP_002771750.1| putative copper chaperone [Brevibacillus brevis NBRC 100599]
    MNVTLNVQGMSCNHCVISIEGALQKLDGVSKATVSLADNQVSVTFDESVVSLDNVKETIEDQGYDVV

    >gi|226311955|ref|YP_002771849.1| dihydrolipoamide dehydrogenase [Brevibacillus brevis NBRC 100599]
    MSQEFDLVVLGGGTGGYVAAIRASQLGMKVAIVEKEKLGGTCLHRGCIPSKALLRSAEVFSTLKEADKYGVSAGAVGYDF
    TKIQERKQGIIDQLHKGIQYLMKKGSITVFEGFGRVMGPSIFSPQAGAVRIEKENGDQEMIVPRFLMLATGSRPRTLPGL
    VIDGAYVVTSDEALQWEQLPASVVIVGGGVIGIEWASMLNDFGVEVTVVEYADRILPFEDEEVSKELARLLKKRKVNIVT
    GAKVLPESLEKGEGKVSIQAEVKDGVQTFEAEKVLVSVGRQANVENIGLEATEIKVERGVVVVNEFFQTAEPHIYAIGDV
    IGGLQLAHVASHEGILAVEHMAGQNPHPMDYTKVPKCTYSRPEVANVGLTEKEAKEQGYDVKIGKFSFKPLGKALIHGEN
    DGFVKLVVDAKTNDLLGVHMIGTHVTDMISEAGLARVLDATPWEIGQTIHPHPSLSEAIMEAAQAVDGKAIHN

    >gi|226312001|ref|YP_002771895.1| cytochrome c biogenesis protein [Brevibacillus brevis NBRC 100599]
    MNKSNRTYVRIAVLGVLLVALVFALYSSFVKDPGAVKVGSDAPNFSLEQLNGPELTLESLKGKGVILNFWGTWCEPCKKE
    MPALQKQYTKFKDKGLVVLGVNIGESPVAVDPFVKQFGIDFPILLDRQSEITKLYRIGPIPTTFFIDPDGEVKEVFIGQL
    DEAMIESKITKILP

    >gi|226312017|ref|YP_002771911.1| hypothetical protein BBR47_24300 [Brevibacillus brevis NBRC 100599]
    MQVEYDTVIVGGGIAGLQTAIQLARCLRRVAVIDMPGGRSTIAKAYRNILGFSEGVSGDFLRHAGKEQAQKYGAILITDE
    VTKLSTDPSGLFSIGTKSGIHTLTSRTLVLATGMRDPFPAIPSFSDCVGISIFL
    CPDCDGYETVDKATAIIGAGPHAVSI
    ADELIYYTNRLTVINHAEMQVDTQTVSELSKRGIMYREEKVYALHHTAGQLQEIELSSGERLSVERAFLAFPGAHALTEL
    LRGFSVQIHEKGHIQTNPRTKETDHPNIWAVGDINEHSQQVSIAMGDGTQAAIWIQKRLRELER

    >gi|226312124|ref|YP_002772018.1| probable thioredoxin [Brevibacillus brevis NBRC 100599]
    MREIKTEAEFEQVIAATKPVIVKFFTDWCPDCHRIDPFMPAVEEKYKEQLDMIEVNRDTLPDLSEKYDVFGIPSFIAFHN
    GKELVRFVSKLGKSREEIEHFLDRAIQVSKGIEQA

    >gi|226312134|ref|YP_002772028.1| hypothetical protein BBR47_25470 [Brevibacillus brevis NBRC 100599]
    MQVQKPYRILLYYKYTPIENYEEYAAEHLKFCKDNGLKGRIIIAPEGINGTVSGTIEQTDAYMEYVRKDPRFSDMWFKID
    ESEEHAFKKMFVRAKKELVTWRLEEDVNPNELVGTYLNPKEWYEMMQEEDVVILDGRNYYEYDLGHFRGAIRPEVDSSRE
    FPEWIRDNMSQFKDKKVLTY
    CTGGIRCEKLTGVLLQQGFENVYHLEGGIVTYGKDPEVQGRLWDGKCYVFDERISIPINH
    TEEDVVIGRCHYCGTVEDRYVNCANPFCNKQHFCCTECETKFKRSCSDECRDHPRNRYVEAEEKAKLEAAGSNV

    >gi|226312194|ref|YP_002772088.1| regulatory protein ADA [Brevibacillus brevis NBRC 100599]
    MITAEMKSEYYQALLDKNSEYEGVFFVGVKTTGVFCRPTCPARKPKFINCEFFDHAKQALLASFRPCQRCRPLSHPNHVS
    ELVRLLVNAVEENPEQRWTENDFQRLSVDAATARRQFKKRFGMTFVEYARARRMGIALKEIREGKAVIDAQLSTGYESSS
    GFRDAFSRIMGAAPTLLGDHQVLKASWLDTRLGPMIAIADEEALYLLEFIDRRGLEREVERLRQRTKSAIIPGSTAPIRS
    IERELEEYFDGGRTQFATPLFLCGSPFQRMVWEHLQTIPPGHTSSYSDVAAAIGKPSAFRAVAQANGANQLAIVIP
    CHRV
    INSNGDLGGYGGGLSRKRWLLHHEKETSHLL

    >gi|226312269|ref|YP_002772163.1| probable peptide methionine sulfoxide reductase MsrA/MsrB [Brevibacillus brevis NBRC 100599]
    MNSDTHPFEIATFAGGCFWCMVSPFDKMPGIQKVVSGYTGGHVENPTYEEVCSDTTGHYEAVQITYDPSLISYEELLQMF
    WRQIDPTDAGGQFGDRGQSYAPAIFYHNEEQERLAQKSKQELDASGRFQKPIATLILPAKPFYPAEDYHQEYYKKNPVRY
    QYYRAASGRAKFTKEAWRDRAKQEELKKILTPLQYEVTQNNGTERPFTNEFWDHKEEGIYVDIVSNEPLFSSLDKFDSSC
    GWPSFTKPMQAENVTEHVDLTHNMIRTEVRSKEADSHLGHVFEDGPGENGLRY
    CINSAALRFIPKDRLEEEGFGEFKRLF
    EKE

    >gi|226312346|ref|YP_002772240.1| 2-oxoacid dehydrogenase E3 component [Brevibacillus brevis NBRC 100599]
    MVVGEVAVETDVVVIGGGPGGYAAAIRLGQLGKSVVLIEKEVLGGVCLNRGCIPSKALIHTAGEYHKLNRLNKLGIQLPT
    GKATFHMPSWQTWKSSVVAQLNKGIDYLCQANGVTVVKGTATFLSSDRIGVETGGDFETYKCKQAIIATGSRPFIPSFLK
    TDGEYILDSTDMLALDDVPETLAIIGGGYIGMELGMAFAKLGSQVTIIEASERILPQTAAHLSQEVLKQAKQLGMTVKIA
    TKVEKAEVANGRVTLVCTSEKNGSESITAHKTLVTIGRVPNTGELGLAQAGVEMDERGYIPVTSTGSTNKAHIYAIGDVT
    PGPALAHRAAKQGIVAAEVIAGLPSSVDSPFVPYVIFTEPQIAGVGMTRDEAELQGYKVKAATFPYRANGRALAIDEGEG
    FAEVIVDQESHLLLGMHIVGADASNLIGEGVLALELAARVEDVALTMHPHPTLSEVWLEAAEAVLGHAIHIVNKSK

    >gi|226312361|ref|YP_002772255.1| hypothetical protein BBR47_27740 [Brevibacillus brevis NBRC 100599]
    MTDKKPTIEPGWNFDNSYTTLPKSFFSRLNPPPVRSPKLAILNERLAKSLGLNVEALQSEEVIAMLAGNKTPEGAMPLAQ
    AYAGHQFGHFTMLGDGRALLLGEQITPTGERFDIQLKGSGRTPYSRGGDGRAALGPMLREYIISEAMHGLGIPTTRSLAV
    VTTGESVYRESELPGAILTRVAASHIRVGTFQFAARFCSIEDLRALADYTLQRHFPEIETEENRYLLLLKGVIQRQAALI
    AKWQLVGFIHGVMNTDNMAISGETIDYGPCAFMDTYDPATVFSSIDVQGRYAYGNQPYIAVWNLSRFAESLLPLLHENEA
    QAVKIAEDVLAEFSKLYHSNWLTGMRAKLGLFNEEEQDEALIEGLLNMMKEHRADYTNTFRALTLNQPEETVLFGTSEFT
    EWHEQWKARLTRQPEDTDAVQQGMKKNNPAVIPRNHRVEEALEAAWKEGDYTVMERLLTVLSDPYAYTPEQVEYTTLPAE
    SARPYQTF
    CGT

    >gi|226312419|ref|YP_002772313.1| hypothetical protein BBR47_28320 [Brevibacillus brevis NBRC 100599]
    MLLRYFYDEKLAHASYLVGCQKTGEAIVIDPARNLAPYFQVAKAEGVTIVAAAETHIHADFVSGARELGALHQAKLFLSN
    EGDEDWKYQYVKGLNHQLVHDGDRFFIGNLLFEVMHTPGHTPESISFLLTDLGGNADRPIGIFTGDFVFVGDIGRPDLLE
    KAAGMKGTSELGARAMFQSLQKFKQLPDYMQVWPAHGAGSACGKALGAVPSSTVGYEKLFNWAMSHTSEEEFVQALLDGQ
    PEPPTYFAVMKRVNKEGPALLKELPVVQEFNSLEAVNKSLENGQIIDTRPFHKFAKGYLAGTLHIPFNKSFANWAGWIVD
    YDRPVHILTTPYELDEILQALHAVGIDHVTGFIDSTKLMESEVSSLETIEEVTPLEIAERVEKGEVHVVDVRNLAEWKEG
    HIPDAQHIMLGSLAMRLDEIPHDKPLLVQ
    CRSGARSAIGASILKANGFKDVMNLSGGILQWQINGLAVVQRG

    >gi|226312588|ref|YP_002772482.1| dihydrolipoyl dehydrogenase [Brevibacillus brevis NBRC 100599]
    MSELKRIDTLVIGSGPGGYAAAVRSAQFGMTTVVVERGQIGGVCTNIGCIPSKSLIAEAHRYNLHSQWNHAVASVSFEEA
    QAFKQAVVNKQSGGVHYLLRSAGVTILEGEASFIDQHTVVMKGPETEQLISFKYAILATGSRPIELQALPFGDRILSSTE
    ALSLSQLPASLVVIGGGYIGVELGQMFAKFGTKVTILEGGEQVLPGFEADLTALVGRQLNTDGVTIITGAKAVKAEQDTE
    GLTLHYLKNDEEHLVRTEYALVTVGRKPNTDGSLGLNRIGLPTTSRGLLETDEQCRTAIPHIFAIGDIANGPGLAHKASY
    EAKVAAEAIAGEPSAVDYKAIPLVVFSEPELASVGLTETECKAKAVPVVVGKSSFSINGRALALKAAVGFVKVVADPVSG
    IVMGAQIVGAEASTLISELALAIEMGATVEDLAMTIHPHPTMGEVIMEAAGNAAKKHKKINKIQSRDNQDR

    >gi|226312697|ref|YP_002772591.1| probable thioredoxin [Brevibacillus brevis NBRC 100599]
    MQELTSTELIQYLQEKESVALFVYTPMCGTCKLAARMLGIMQEALPTVPLYQININTAPALAEQWQVTSVPALLIFQRNE
    LVARHYAIQSVGFLYDVLKPLA

    >gi|226312797|ref|YP_002772691.1| thiol-disulfide oxidoreductase [Brevibacillus brevis NBRC 100599]
    MKKLLLAVIVLLGGGLAVWEKPQETAAIVAEVQKPEVGFAAPHFTLTGLDQQTYKVEGKRAKPLVLNFWASWCGPCKLEA
    PDLQKVYEKYGGQVDLYGVNVTSNDSPEAAMAFVTNYKLTFPIPMDVAGTVSNRYKVMAFPTTYLIDADGIVRKKIIGMV
    DAPTLELELRQLLSPKP

    >gi|226312882|ref|YP_002772776.1| dihydrolipoyl dehydrogenase [Brevibacillus brevis NBRC 100599]
    MVVGEFTTEVDVLVIGAGPGGYVAAIRAAQLGKTVAVVEKAELGGVCLNVGCIPSKAMIHAAHTYEHTQHTESMGITMEN
    VKVDFAKVQEWKSGIVKQLTGGVGSLFKGHKIQVIPGEALFVSENEVRVFHGYDVNRYRFQH
    CIIATGSRPIELPAFPFG
    KRVMSSTEALSMTELPKSLVVIGGGYIGIELGTVFAKFGTKVTILEGSDQILPGFEPDMPRLVERKLKKLDVTIHTKALA
    QGMEETENGVIVTAEVKGEQQKIEAEYVLVTVGRRPNTDELGIRDIGMNMTDRGLIVVDKQGRTSIPNVYAIGDIVAGPA
    LAHKASYEGKVAAEAIAGHPAEVDYKAIPAVVFCDPEIASVGINEKEAKEKGIDYIVGRFPFAANGRALSVNAGEGYVKL
    IAEKETNLVLGAQIVGPEASNIIAEIGLAIEMGATLEDIELTIHAHPTLGEVTMEAAELALGRPIHVMK

    >gi|226313399|ref|YP_002773293.1| hypothetical protein BBR47_38120 [Brevibacillus brevis NBRC 100599]
    MEHIQVLIAGGGIAGLSAAIWCQRLGLSCLLIEKTDRLGGQLHHIYNEITDFPPLVYDQGAALVKVLIEHPFIQQQNIRF
    NETILSIDQETKQVTTSKSVYRVDYLLIATGVGWNEIPALAG
    CPSVLSPWFSTTAQAHTIAGQDIAVIGGGDRALESAAN
    LSLHARQVYLLVRSKKWRARPEWQKKITGLPNIQVLWETQVSDYQDEEARTVLSLTSTREGNPETIVVDWILPRIGVHGN
    TTGLNGLDTFGDEYLQTDSYHRVNSPWIYAVGDVSNGAAYASLSLAVGQAMKAVKHLSLQIQNTKSMSL

    >gi|226313450|ref|YP_002773344.1| hypothetical protein BBR47_38630 [Brevibacillus brevis NBRC 100599]
    MAVAERTQTQKLTFFTYPSCTSCRKAKAWLAENGVNYEERHLFKNPPTAEELLDIIKMTSNGLDEILSTRSQRFKNLDVD
    INDMSVKELLEMLSEEPQLLKRPILTDGENLIVGFNSSAMQNLLS

    >gi|226313471|ref|YP_002773365.1| glutathione peroxidase [Brevibacillus brevis NBRC 100599]
    MSLYDIAVKTISGEEKTLAAFKGHVLLIVNVASQCGLTPQYKGLQELYERYQDKGLVVLGFPCNQFAGQEPGTEEEIATF
    CDRNYGVTFPLFAKIDVNGPGTHPLYQYLKEHAPSEENPDIEWNFAKFLVDKDGRVVKRISARTQPEEICSDIESLL

    >gi|226313548|ref|YP_002773442.1| hypothetical protein BBR47_39610 [Brevibacillus brevis NBRC 100599]
    MIHISEAAVTRLQHMLEQESSTLFIRFGVKDGGCSGMTYGLGFDDTYQEGDTTIDMDSVKLVVNPESYPYVDGVEIDYKE
    TGMMGGFTIQNPHAIATCGCGSSFRTALQRGKREKCE

    >gi|226313577|ref|YP_002773471.1| hypothetical protein BBR47_39900 [Brevibacillus brevis NBRC 100599]
    MSVIELGSGPGFVMEKVMQAFPNGRVTGLEIDPLLVDYSRNYLTQKHSDRFEIVAGSIMETGLPSDSYDFAITRLVLEHL
    PDPVGAVREVARLLKPGGRAVFIDNDFEMHIMTTPHVPELRELYDAY
    CAARYAEGGNPKIGRELPTVLKQGGLGKIDFEV
    IGAHSELLGYEMFLKSEGVGIPVQLVRDGYLSSKALGKLSVAWRNMLNTEGHSILRQLYMAVGEKSV

    >gi|226313680|ref|YP_002773574.1| thiol peroxidase [Brevibacillus brevis NBRC 100599]
    MTTAVERQGAFVFKGGPVTLLGPEIKVGDTAPNFTVVGGDLSPVTLEDSKGTVRIISVIPSIDTGVCDAQTRRFNEEAAK
    LEGVTVLTVSVDLPFAQNRWCGAAGIDKVKTVSDHKDLSFGTAYGVAIKEFRLLSRAVFVIDANDKVVHAEYVAAAGEHP
    NYEAAIAAAQAAK

    >gi|226313750|ref|YP_002773644.1| probable MTA/SAH nucleosidase [Brevibacillus brevis NBRC 100599]
    MRYGIIGAMDEEIALYLEAMQETTTATKAGITYYTGKMEGKDVVLCKSGVGKVNAAVTTQILIDSFQVERVIFTGVAGAV
    HPELNIGDIVVSTDCIQHDIDVTPLGFEPGQIPFTEQWTWQADAGLMQQAIDAGKELEAGVQVVSGRILSGDQFVASREK
    VQWLYEQFAAHCTEMEGASVGQVCAMNGVPFVVVRSMSDKADGSAHVNFVEFTKLASQRSYAIVRNMLTATRAAIAAGVI
    VYSTKN
    CVDCDMVKNWLTVKDVSFEVRDVMTSRAYQEEVERFGFMGVPVTVVGDKAVKGFAPSELEELVK

    >gi|226313775|ref|YP_002773669.1| probable methylated-DNA--protein-cysteine methyltransferase [Brevibacillus brevis NBRC 100599]
    METKKDQTVRWSILRHGDWSIYLAATASGLCYVGSVNQPFAELEAWVEKHRPHSALVQDDPWLKPFATELMEYLQGMREH
    FSMDCDLSGTPFQLAVWEALRQIPYGQTASYTDIANIIEKPAAVRAVGAAIGANPVLITVP
    CHRVVGKNGSLTGYRGGLP
    MKTTLLNLEKKSNRGVKHG

    >gi|226313779|ref|YP_002773673.1| molybdopterin biosynthesis protein MoeB [Brevibacillus brevis NBRC 100599]
    MDTRYSRQILFHPIGRSGQEKLGQSRVAIVGMGALGTVLSNHMVRAGVGFVRIIDRDFVEPSNLQRQMLYDESDAAEHLP
    KAIAAHAKLTKINSAVTIEPIVADLTAYNAEELLADVDLVLDATDNFQVRYLVNDVCVKHSIPWVYGGAVSATGTFTAIR
    PGITPCLRCLFPEAPNPGEMPT
    CDTAGVIGPIIHIVASYQATEAFKLLVGAIDELNPNLEHFEIWHNRHQQIKVVNARRD
    DCPTCGEKQFSFLQPDTQDGQAVSLCGRDTVQISPAAAMTLDLHALATRLSPLGQVEQNKFLLRFRVDTYTLVIFPDGRV
    LVQGTDDVSLARSLHAKYIGA

    >gi|226313930|ref|YP_002773826.1| thioredoxin [Brevibacillus brevis NBRC 100599]
    MSICHTTDSTFQHDVKSEGYTLVNFWAPWCGPCRFFGPILESFDREHSSEVRVLKVNVDEQQEIANQYGIMSLPTTILLK
    NGEMIDKAVGAAPLAELKQFVFKHR

    >gi|226314355|ref|YP_002774251.1| hypothetical protein BBR47_47700 [Brevibacillus brevis NBRC 100599]
    MITLTESASLKVKEMLAAEGKPDVFLRVGVRTGGCSGFTYGMGWDEEMKEGDETFEQNGVKIVVDKDSYPYIKGTQIDFK
    ESMMGGGFSIENPNAVASCGCGSSFKTALAEGKAEKCDD

    >gi|226314451|ref|YP_002774347.1| thiol-disulfide oxidoreductase [Brevibacillus brevis NBRC 100599]
    MRLREEMPNFPGITEWINGQATKADLAGNPVLVHIWSVSCYMCKESMPSINEWRDQYAANGLKVIGIHTPHSEKDTDIEM
    IKKAIAEQHLTHPIAIDNDRKIADTFQNEYVPAFYLFDEALQLRHFQAGEKGLQLVKKRLFRILGIKEES

    >gi|226314453|ref|YP_002774349.1| hypothetical protein BBR47_48680 [Brevibacillus brevis NBRC 100599]
    MSMTMKAYLYNKCDTCRKAKKWLTDQNIGFEEIPIVDAPPSKEELRQIWQTSGLDLRKFFNVSGVQYRELGLKDKLPTMS
    EDEMLELLASNGKLIKRPLIASDRTVTLGFKEEELEKAWGGKA

    >gi|226314533|ref|YP_002774429.1| hypothetical protein BBR47_49480 [Brevibacillus brevis NBRC 100599]
    MSLVLQTPAASPEVARTHFLEKLSLETDVSDVWSDIQNRVEDFYILDARSEKAYRDGHVPGALNLPHSLISTDTTAALDP
    TKLLVVY
    CWGPNCNGAAKACAKLAALGFRVKEMLGGMEYWEKEGNPIE

    >gi|226314740|ref|YP_002774636.1| dihydrolipoyl dehydrogenase [Brevibacillus brevis NBRC 100599]
    MNTIAVIGGGPAGYVAAIVAAQKGKQVTLIEQRVLGGTCLNEGCMPTKSLLESAEMAEKIKHAGRFGIRVPEQEVSIDWP
    GVQSYKNNIVEQLVMGIGFLMRKNKIKVLTGKARFVSQRQIAVKMDQGEEIVEADKIIIASGSEPMELPFAPFDGRWIIH
    SGHAMSLSAIPETLLIIGGGVIGCEFASIYSRMGCDVTVIEMADQILPGEDADIAGVLRDQLERTGVKILTATSLTSVDQ
    QTKTVRFKNPDGSGEATAEIMLVAVGRMPRTAELQLDWAGVAFGKQGISVNGHMQTNVPHIYACGDVVGGIQLAHVAFHE
    GTVAALHACGLDAKANYRAVPRCIYTSPEIAGVGLTEKQARSQYGDVRIGEFPFSVNGKAIILGEAIGKVKVITEPEYNE
    ILGVSIVGPRATELIGQGTVMIHGEMAADMMETFISAHPTLSEAVHEALLSAIGHAVHA

    >gi|226314757|ref|YP_002774653.1| SCO1 protein homolog [Brevibacillus brevis NBRC 100599]
    MKKTAWLIMLSILMVLVTACGPARYDYNYPVNEFAYTDQEGKPFSSSDLENKVWVANFVFTYCGTVCPTMTANMAELQKK
    AKEAGVDVEFVSFSVDPEKDTPEALKSYLGKFNADFSNWHALTGYGFDEIKTFILKSFKTPIEKDSNSDQIIHDTFLYLV
    DQKGTVVNRYEGMTDVPYNQIIEDMKALQE

    >gi|226314848|ref|YP_002774744.1| probable thioredoxin reductase [Brevibacillus brevis NBRC 100599]
    MSEQKVYDVIIAGAGPAGMTAAVYTSRANMSTLMLERGIPGGQMANTEDIENYPGFTSILGPDLSTKMFEHAQQFGAEYA
    YGEIKEIRDEEPYKRVITGDKEYLTKSVIVATGAEHRLLGVQGEKELSGRGVSY
    CAVCDGAFFRNKELVVVGGGDSAVEE
    AVFLTRFASKVTIVHRRDQFRAQKILQKRAFDNEKIEVIWDTELKEIRGEGKVQAVLLQNTKTGEQREYPADGVFIYVGM
    DPLTASVRPLGITNDAGYVLTDEKMNTKVKGVFAAGDVREKMLRQVVTATGDGSIAAQSAQHYVEELNEKLKEQNVTIS

    >gi|226315102|ref|YP_002774998.1| protein disulfide oxidoreductase precursor [Brevibacillus brevis NBRC 100599]
    MDVSRSKQWWLWILLGVVMLAVGISAWWGTASAQEEVKVVYVYSDSCGYCTEFGPTFEKVVKEYPPEMIQRLDIHEQKEL
    DEASRLGAEATPTVFVVEQGKVIDKLEGAVPENTLRSFLQRNLNQTLSKNG

    >gi|226315178|ref|YP_002775074.1| hypothetical protein BBR47_55930 [Brevibacillus brevis NBRC 100599]
    MEFQAKENGFVTQLSYGELHVSGDEQYGFRPYQLLVSSIAVCSGGVLRKVLDKMRMPCTDMKVTADVQRNEAEANRVEKI
    HLHFIITGENMKEEKVQKAIEAASKN
    CPMVQSVKGSIVVTESFELVS

    >gi|226315290|ref|YP_002775186.1| hypothetical protein BBR47_57050 [Brevibacillus brevis NBRC 100599]
    MSKARSYYESANLSHIPELMKLAPDAAASYFSFERQIYQQSHQLPVKTKELIAIVVAHVTGCPYCIDVHVKKYKELGGTM
    EEIMEALLVAAVTRSGAILSHGVNALLAYHDAPGKPDCFC

    >gi|226315329|ref|YP_002775225.1| hypothetical protein BBR47_57440 [Brevibacillus brevis NBRC 100599]
    MPVETFKATAHLQKGMVVKASSRNFEITIDEPKSLGGTDTGMNPVELVLSALGACQSIVARVYARKFNVQLDDFWVEVEG
    DLDTDGFMNKSDVRRGYSEIRYTFHIKTDAPREQVESFVEFLEQTCPVGDTIANPVTLKLNGIVIEKPSEIKAND

    >gi|226315359|ref|YP_002775255.1| probable organic hydroperoxide resistance protein [Brevibacillus brevis NBRC 100599]
    MQPIYTTSVTASGGRNGVVKSSDGVLDLEIRTPKEMGGPGGAYTNPEQLFAAGYSACFDGALNLVARTKRIKLESTTVTA
    NVSFGKDAEGGFQLHTVLEVKVNGVDRDTAKELVEEAHQV
    CPYSRATRNGNMHVELRVI

    >gi|226313734|ref|YP_002773628.1| hypothetical protein BBR47_41470 [Brevibacillus brevis NBRC 100599]
    MNRSQYKYDVIIIGGGPSGLMSAIAASGQGARVCLVEKGSKLGRKLIISGGGRCNVTNAKEQDELIKQMPGNGRFMYSAL
    TQFGNREIIQFFEELGVALKEEDRGRMFPVTDKAVTVAQALIDLLKQRGVSIHLNAAVKEVLYSEGRVGGIMLQSGEKIT
    APCVIIAVGGCSVPQTGSTGDGYAWAKAAGHTITELYPTEVPLTANDSFIRDKSIQGLSLRDITMTLYAPNGKKINTQEG
    DMIFTHFGISGPASLRMGHYVSVSQRKYGAVPLSLTIDLMPDKTAEEITAESWQLIEEQPKKAVKNAIKGFLPERIIPLL
    LSLAGISDETTYSHMKKQEWSKFTNLIKAFPLTITGTLSLEEAFITGGGVSVKEIDPRSMRSKLMDGLYFAGEVMDVHAH
    TGGYNITIAFSSGYSAGTHSAQEAFEFFYENDV