Brachyspira pilosicoli 95 1000 uid50609

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|300869677|ref|YP_003784548.1| Fe-hydrogenase large subunit family protein [Brachyspira pilosicoli 95/1000]
    MNINNNAAQLKKDILVRITTLFIEDRLIEEIDRMPMEIIPRDSKSIRCCIYHDREIIKNRIIARLGISVEGKEDSGIPLS
    EYAKLALEREKPTWPMLTVLDEACNACVRANFMVTDACQA
    CLARPCMMNCPKNAITILDEKRAYIDSSKCINCGLCLKNC
    PYHAIIYIPVPCEESCPVGAINKNEQGKEVIDYHKCIFCGNCMRECPFSAMMDKGQLLDVLKHLKFDKKVNVMYAPAIAS
    QFNAKPGQLKSALLKIGFHKVWEVALGADVTSDREAAEFEERMERGDKLMTTSCCPAYVKAVRKHVPELVPCVSETRTPM
    HYTAEMMHAEDPDAVNVFIGPCLAKRRESIDDDLVDYCLSMEELDALFIATGTDVSKEPDLDIGDVPTASGRKYAMSGGV
    AEAVKIRLKHPEKLKAAVINGLDKEGMKQLRAYGKVQSGETPLTDDTPNLVEVMACNGGCVGGPCVVKNPKAATVLLQKY
    ASTGKELNKE

    >gi|300869723|ref|YP_003784594.1| hypothetical protein BP951000_0084 [Brachyspira pilosicoli 95/1000]
    MKKNIFTSSIGIIVSGAIIGALAAWLSVMGNPANMGICVACFTRDLAGALGLHRAAAVQYIRPELIGLVIGATVSALISK
    EFSPKGGSSPIIRFILGFFAMIGALVFLGCPWRTLLRIAGGDINAIFGLIGIIIGGGIGVFFWKQNFSLGQPKAYNNKLV
    GFIPLVISIILLILLLKQTKFSEGGAIFFSESGPGSMKAPLIIALVVSIIIGFIAQKSRFCTVGGVRDGIFMKDFHMTKG
    VIAFIVAALIVNIITNRFNVSMENQPIAHTNILWNTVSMILTGLAFTLGAG
    CPGRQFIQSAEGNMDSFVFVIGMLVGAGF
    AHNFNLASSTTGPTVYGMFAVILGLVFCVIIGFTMKENQ

    >gi|300869812|ref|YP_003784683.1| putative rhodanese-like protein [Brachyspira pilosicoli 95/1000]
    MSNTLSLIILLIVFFIIITFVKKIIFNIMSKGKYKNIKLNEAIELYKNNKNIGLIDVRSYQEVQYSGYIKNSINIALDDS
    NFDNKMSKLDKDKEYIVY
    CASGSRSSYACMRMYKLGFKNIYNLTYAGYSALSNALKK

    >gi|300869813|ref|YP_003784684.1| thiol disulfide interchange protein [Brachyspira pilosicoli 95/1000]
    MRKIYIFLFIIFSLTAYSQSFNSLLNKNTEAIIVFSLSTNDNKITVKANIPEGYYAYLESKIANKILFFADNKEINTTYP
    KGEKYHEDIIIKGEQEFILNDIDINKINFIKTTYQLCSAKDNVCLQPQSKVIYGEEIDIPNNNVTDEKPENASSIENYIK
    GSNNIFITLILIFAAGLASVLLPCTYPLLSITVSILGTTTGEKNNKKSSVLASLLFALGVITTYTLLGAVVSVAGFAFHK
    TILFGSIGYNPIVLTILVLLFLYFTFSMAGFYEIKAPSFLQSAKTNAYAKKNQSIFHKYIMGLLAGIVATPCAAPIIAVI
    LEIGFLNPVFATLYMAVYALGFASVLFLLGTFASILTKMPKAGTWMVYVKYIFTFLMMIISFYYANILFGVLGFNKISYI
    LASVTILVFAILVYIIKNKTAMLSALEKKIFVSVLIISIALGSIYGIIKQKSEVSNTISYTEALELSKQNNKPILIDFSA
    VW
    CANCYELKEKVFVNEELKKFIDDNLIFTEVDVDKYKNISDEYNVKWLPWIIVIDRDKNILYTKNSFSSFDDKMALSIK
    EDLEKVINK

    >gi|300869836|ref|YP_003784707.1| NADH oxidase [Brachyspira pilosicoli 95/1000]
    MKVIVIGCNHAGTWAAKTLKATDPNCQVVTYDRNDNISFLACGIALWVGGVVKDPKGLFYASPEGLKSEGIEVYMGHEVT
    KIDWANKKMTVKELKTGKEFEDNYDKLILATGSWPVTPPIEGLKQEGTTYGLKKGIFFSKLYQQGQDIINEIAKPEVKKV
    MVVGAGYIGVELIEAFKNHGKEVILMEAMPRVMANYFDKEITDEAEKRIKDAGIELHLGETVKKFEGDDRVKKVVTDKGS
    YDVDMVVMSVGFRPNSELYKDYLETLPNGAIVVDTTMKSSKDENVYAIGDCSSVYSCSSKSHEYIALATNAVRMGIVAAN
    NILGKKVNYCGTQGSNAICVFGYNMASTGWSEETAKKKGLKVKSNFFRDAERPEFMPTYEDVLVKIVYEEGTGRLLGAQI
    ASKHNHAEAIHAFSLAIANEMTVQDFALSDFFFLPHYNKPLSWMTMVAYTAK

    >gi|300869903|ref|YP_003784774.1| rhodanese-like domain-containing protein [Brachyspira pilosicoli 95/1000]
    MKRNIFIILALLITTIISNAQTTQTNEIVYELDNVKVVNKNGLAVKDFISLWKSDPNIVLIDVRTPEEIKQTGTIKGAIN
    IDYRAKGYAKKILSLDKNKKYMFY
    CKSGGRSGKTVQYMLDNGFKNVNYLKDGGYTELNAALK

    >gi|300869953|ref|YP_003784824.1| methylated DNA-protein cysteine methyltransferase [Brachyspira pilosicoli 95/1000]
    MNIIRLENSQIDDKVFLYKSPIGNLYLTHYKDYITSISFQSNYSISTDKEPEIIKEAKKELDEYFNLKRKIFDIPIAVYG
    SDFQYKVWIETYKIPFGEIETYSNIAKKISNSFGSIFRAVGSAEGKNKIPIIIP
    CHRVVSKDLKLTGYAGGIEKKEYLLK
    LEGFNIDKLKIIR

    >gi|300870033|ref|YP_003784904.1| methionine sulfoxide reductase B [Brachyspira pilosicoli 95/1000]
    MELRKLTEEERNVIIFKGTEYPFTGEYNDFFEEGVYCCKQCGAELYRSEDKFKSKCGWPSFDDEIKGAIRRSLDEDGYRI
    EITCNNCGAHLGHVFQGEHLTDKNIRH
    CVNSISLIFKPKEK

    >gi|300870152|ref|YP_003785023.1| thioredoxin [Brachyspira pilosicoli 95/1000]
    MVELDKDTFDEKVINSKELCLVDYFGDTCEPCKALMPHVHELAKQYEGKVPFYSFNTSKARRLAIREKILGLPTIAIYKD
    GAKVKEVTKEEATIENIKAMVDSML

    >gi|300870356|ref|YP_003785227.1| glutamate synthase GltD [Brachyspira pilosicoli 95/1000]
    MSDVMTPIPFGNLMNWVLEEKKSGKVFGISRAFKADKAKYYEIFGRKLETPIGPAAGPHTQLAQNIIAAYYTGSRFFELK
    TVQKMDGEELSKCVAKPCITANDECYNCEWSTELYVPQAFDEYVKAWVALKVIAKEWDLGEMDGFQFNMSVGYDYEGIKT
    EKIDNFIEGMKNASNTPIFKECKEWLTNNISRFKNFKKEDIDKINADICNSVTLSTLHGCPPTEIEKIASYLITEKKLNT
    FVKCNPTLLGYDYARKTLDEMGYDYISFTDFHFNDDLQYSDAVPMLQRLQKLAEDNSLAFGVKITNTFPVDVKQKELPSE
    EMYMSGKSLFPLSMTVASRLSKDFDGKLRISYSGGCDYFNINDVIDAGIWPVTMATTFLKTGGYQRGEQIAKNLKEPKAF
    TKVDVAKTEKIIEWGKKSKHHVKPIKPLASRKVNKKVPLVDCYIAPCMETCPIHQDLTTYIRLNSKGQYEESFKVIIEKN
    ALPFATGILCPHTCMDKCTRQFYEEPVSIRACKLEAAKAGYSKVIGTLKAAPSIGKKAGVIGAGPAGLSAAFFLARAGVE
    VTVFDKREKAGGVVANIIPRFRITAEEIGNDISL
    CKQMGVKFELGKEIKDIKEFAKNYDYTIVCIGAHKNMPLKLEAGES
    MNALKFLEEFNKTNGNVELGENVVVIGGGNTAMDAARAAKKNKGVKNVRLVYRRTKRYMPAHEEELKEALEDGVEFMELL
    APVKLENGKLLCKKMELSDYDEKGRRNVVETNETVEVPANTVIASIGEQIESDFYKSNGIDVDDKGKPKCNANNESSIKN
    VYIAGDGLYGAATIVEAIRDARVVAESILGKAIAPDLASVSTEEISYSKKGNLKEVSKDPEATRCLSCDYICESCTEVCP
    NRANVSIKVEGGAKISQIIHVDYMCNECGNCETFCPYSSAPYKDKFTLFATADDMKNSKNDGFLFLDKEGNAKLRIDGKE
    ESYKAGSSKNFNGVYSIVDSVFNNYKYLILK

    >gi|300870430|ref|YP_003785301.1| sarcosine oxidase subunit alpha [Brachyspira pilosicoli 95/1000]
    MESYDVVVIGGGPAGLAAAISAKENGIDNLLMLERDAVLGGILNQCIHNGFGLHRFGEELTGPEYAYRFIEKVYDLNINY
    KLNTMVLDIVLNNDKTKKITYINKEEGLVEINAKAVILAMGCRERSRGALNIPGFRPAGIFSAGAAQHLVNIEGYMPGKE
    VVILGSGDIGLIMARRMTFEGAKVKVVAEILPFSGGLKRNIVQCLDDFGIPLKLSHTVVDIKGKERLEGVTIAKVDENMK
    PIKGTEEYYSCDTLLLSVGLIPENELSKEIGVQINPITSGAIVNESLETSIDGVFSCGNVLHVHDLVDFVSEEAETAGKS
    AASYVIKNKRRDDSNSISLKGSSGVRYTVPSMINVDNVDDHVMVRFRVSNIFQNKFLNVYFDGERIIHKKHLIFAPGEME
    TVKLDKAMLSKEGLKNIEFKIEDN

    >gi|300870580|ref|YP_003785451.1| thiol-disulfide interchange like protein [Brachyspira pilosicoli 95/1000]
    MKNIFIIAFSILLLLSCNNNQNTQLINWETNYNTALEKAIKENKSIMIDFYTDWCTICKIMETNVYLDREIASNINYNFV
    PLKINAEDNDKKLLTNQYNISAFPTTVFINTNGFIIKKILGYIDTNDLLEEIKKIEEKSANINREFSNNNPTIEKLKIYI
    DSEYYKEAIEMYDILIKENKIEKEDIPTYLIDIGTLLFYNEQFDEGIKYFNEVLNNYSNSQKLYEAIYFNGIYKIIMGNK
    EEGINYLKSFTNSITNDELRNQYIEAIEYYQ

    >gi|300870597|ref|YP_003785468.1| pyridine nucleotide-disulfide oxidoreductase family protein [Brachyspira pilosicoli 95/1000]
    MYIEKIKMGDYLMKKILIVGGVAGGASAAARLRRLNEEDKIILFEKGPHVSFSNCSLPYYVGGLIPNEETLLLMSPEKFL
    KQFNVDARTNSEVVSIDREKKEVTVISEGKEYKESYDKLILSMGAKPIVPPIKGIEKVNIFTVRNVVDIAKIHSFLGGKK
    NAKVAVIGGGFIGIEMAENIKEAGHDVTIIEALPQIMKPFDYDMVQILHRELIDNGVNLIVEDKVESFEENTVVLASGKK
    IEADAVILAIGVAPETDIAVKAGIELGKTKSIKVDANYRTNDKDIYAIGDVIEIYGALCQDYYRLALAGPAQKQARAVAD
    HINGRTVDNRGYIGSSVIKVFRYNGASTGLSEGYIKAMNLNINYDTVDIIPFDSVSIMPSAKLLHFKLIYEVPTGKVLGA
    QAIGRGNVDKRIDVIATLIKFGGTIYDLKDLELCYAPSFGTAKDVVNFAGYVASNLMNGDFKQIHYSDVRNILEKDPEAY
    FLDVRLKEDFEAGHLEKAVNIPLGALRSRFDEVPKDRPVYIT
    CKTGLTSYTACRILINLGFTNVVNVSGGFIGLSQYEYY
    NDKFYNRKPILTKYFA

    >gi|300870850|ref|YP_003785721.1| putative rhodanese-like protein [Brachyspira pilosicoli 95/1000]
    MTLDNGVIVLTPSEFEKKMQELDDFTIIDVRTELEHNYEGMIENSLLIDFLRPRVFKREIEKLDKNNIYLIYCSVGKLGI
    DAASYMKSVGFENLYVLEGGLKAWNKYLGDDTKVSKFSREEIIEKRKKLIIRLNRIEGQINGMKKMLIKGEYCGDILNQA
    LAVKAAMASVNQEIMEVFLNTCMISPKEKEDFFRYMKKLIK

    >gi|300870928|ref|YP_003785799.1| selenophosphate synthetase [Brachyspira pilosicoli 95/1000]
    MEDIKKEEEKIELLSCALEGGCSAKIPPDLLEKTLSPILKTKVDSNLLSDVDIGDDAGVYKISEDNAIIFTVDFFPPVVA
    DPYLFGEIAACNSISDIYAMGGEPKLALNITMYPKENSLNTLATILKGGQDKATEAGVLVVGGHTITDTAIKYGMAVIGF
    ANPNNITTNSAAKDGDIIILTKPLGTGACLAAMRQGLIKESAITDVFNAMSTLNKKACAVMNKYNAKCATDVTGFGLAGH
    AYKMAKASDVTIEINTSALPMFEKSYEVLDMGCIPGAAFTNMRYVGENILVDENVDYSLKMLTFDPQTAGGLFICVDKAN
    AENMLADLWREGIDCAAIVGRVTKKNREYIHLTK

    >gi|300870967|ref|YP_003785838.1| alkyl-hydrogen peroxide reductase [Brachyspira pilosicoli 95/1000]
    MLEYTNINKRSFIMSLINKKLIDFKVDAYQNGEFKEVSTKDVLGKWSVFFFYPADFTFVCPTELEDLGTVYDELKKINCE
    VYSVSADTHFVHKAWADASATIKNLKYTMLGDPTGILGRFFEVFVEEVGQDLRGSFIVNPEGLIKAYEVHDMGIGRDANE
    LVRKVQAAQYVAEHGGEVCPAKWKPGAKTLKPGIDLVGKI

    >gi|300871232|ref|YP_003786105.1| nox coenzyme A disulfide reductase [Brachyspira pilosicoli 95/1000]
    MKKIIIIGGVAAGMSAAAKARRLDKDAVITVYEKTEYVSWGACGMPYYVGGFFDSSNTMIARTAEATIKSGIDLKVKHEV
    LKIDANNKKVVVKDLENNKEFEDSYDTLLIATGAKSIIPKIENINIGNVSTLKEFTDALNMKEKMKDEKIKNVVVLGAGF
    IAIEAAHNIKHLGKNVRIIQRSDRVFGAKFDKEFSDLAIENIKAHIDLNLNEKVLSLEADSNNNVKAVVTDKGKYDADYV
    VVAIGVTPNSDLAKEAGIKLMENGAIFVDREGKTSIDSIYAAGDCAGIYDRVLNDTSYAALATGANKLGRMVASNLIGGK
    EKFIGSLGSACILCFDLEMARTGITEEEAKKRNINYKTVTVKDIDHTHYYPDYQDLHIKLVYSAEDRKILGGQIAGKRGA
    VLRSDVIAACIHAGLTVDELGMLDLCYAPPFARTWDSLNVVGNAAK

    >gi|300871248|ref|YP_003786121.1| thioredoxin [Brachyspira pilosicoli 95/1000]
    MSVQELKSDNFESAISSDKATLVDFFAEWCGPCKMQTPVLHKVADANSDKMNFAAVNVDEAEEIAAKYGVQSIPTLMVFK
    NGEIVKRAEGMKNEAQLKEWLQEYL

    >gi|300871260|ref|YP_003786133.1| thioredoxin-disulfide reductase [Brachyspira pilosicoli 95/1000]
    MSNNIYDSIVIGGGPAGLSALLYLGRALTNSLLIEKKGIGGQMMSTDTVENYLGFPEEMTSFELVDRMQRHAEKFSKNPI
    VYDEVTKIENIKDKVKTIHTADGKTYQTKTIILAMGGFAKKLGTKGEADFAGKGVSY
    CATCDGAFYRGKTVAVVGGGNSA
    FDEAYFLTRFVNKIYLVHRRKEFRADAINIEHLTNTGKVEYVLDSVIDEICGDGKVTNIKIKNVLDNSIHEQAVDGVFVF
    VGQEPATSILKDTGIAMKESGHIIVDMSTMATNIDGVFACGDSVFKPVRQVANAVGEGAVAAVRVTEYLSHL

    >gi|300871338|ref|YP_003786211.1| peptide methionine sulfoxide reductase [Brachyspira pilosicoli 95/1000]
    MKKIALIAAISIFSLISCNEKLNSESSNIKENKEETKMIPENLKYAYFSSGCFWGTEYWFEKGKGVYDVVSGYAGGHKIN
    PTYQEVCTGLTGHLETVQVAYNPDETTYEDLVKLFFETHDFTQKNGQGPDIGSQYLSAIFYQTEEEKEIAQKYIDMLKEK
    NYDVATTLREYKNFYPAEAYHQNYYERKGSIPYCHFYNKIF

    >gi|300871339|ref|YP_003786212.1| bifunctional methionine sulfoxide reductase B/A protein [Brachyspira pilosicoli 95/1000]
    MYKYIILLLTISIISISCNGKEINNIIVQTNKADISNNNNRDDIKVSTSKLTSKEYEVLINKGTEFPFTGDLLDVKSDGV
    YTCKLCGNLLFKSDAKFNSGTGWPSFDDAVAENIKLVKDGCRVEVSCAKCGGHLGHVFYNEGFTDKQTRY
    CINSVSLNFV
    NKAEFEETNDSTNK

    >gi|300871439|ref|YP_003786312.1| thiol disulfide interchange protein DsbD like protein [Brachyspira pilosicoli 95/1000]
    MNKNIMMIISLIVIAFTISCNDSYAAIKWEKDLASAVKKAKDKDLPIMIDVYTDWCSWCKELDKNTYANKEVIDAAKKMV
    SVKLNPETSKEGADIAQKYGVQGFPTILFISHDGFVLENVGGYVEGEKFVPYMKNAQEKLKKIRIVLQSKEPSLEKLDLY
    MESGNEEESSKIFNALLEKKAISKEAMSKYILGFGLMRAQKNDYDTANSYFDRIIKEYPNSQEVYIAHYYKAVTMVLAGE
    KEEPKKYLEKLLDDPKIPEDMKVQYNTLLSYINEN

    >gi|300871460|ref|YP_003786333.1| thioredoxin reductase [Brachyspira pilosicoli 95/1000]
    MSNLYDCIIIGGGPSGLAAGVYSARARLKTILFEKASFGGQISITDEIANYPGFYEPDEEARHPKNLIGKMIEQAKAFGA
    EIEHKEVVDVKLDGKVKEVKTADGEVYTSKTVIIATGAQPRKLGCKGELEYTGKGVSY
    CATCDANFFEGMEVFCIGGGDT
    AVEEAMYLSKFARKVTLIVRKDYVRCANSIEEKAKANPKIEIKFRTELLELKGDGIVESAIFLNNETGETYEYKADEEDG
    TFGVFIFVGYVPLTKLFEGKVEMKDGFIITDEEMKTNVEGVFACGDLRPKMLKQVITATADGAIAGISANKYIEEHYS

    >gi|300871462|ref|YP_003786335.1| putative glycine reductase complex selenoprotein A family protein GrdA [Brachyspira pilosicoli 95/1000]
    MSILNGKKVIIIGDRDGIPGEAIKACVETVSDAEVLFAATECFVCTAAGAMDLENQKRIKEFAEKFGKENIVVLFGAAEA
    EASGLAAETVMLGDPTYAGALANVALHLDAYHAVEPEFKEAVDASVYDEQIGMAEMTLNVDEIIAEMKRMREENK

    >gi|300871463|ref|YP_003786336.1| glycine/sarcosine/betaine reductase selenoprotein GrdB [Brachyspira pilosicoli 95/1000]
    MPQYKIVHYINQFFANIGGEEKADIAPEKRDGVVGPGAGLQGELKKLGVDAEVVGTVICGDSYFNENLDKAKKEVLDMIK
    SFNPDLVVAGPAFNAGRYGTACGTVAKMVQDELKVAAVTGMYVENPGADMFKKDVYIISTKDSAAGMRDALPKVAKLAAK
    LLKKEEIGTPEAEGYIPRGIRVPLFREKNGAERAVDMLIKKIKGEAFTTEYPMPDFDRVTPGEAIKDITKAKIAIVTSGG
    IVPTGNPDHIESSSASKYGRYSIDDMGETAHGGYDPTYANQDPNRVLPVDVLKDLQKEGKIGELYPYYYTTVGNGTSVKN
    SKAYASEFAQTLVKDGVQAVILTST
    CGTCTRCGATMVKAIEATGIPVVHICTIVPISLTVGANRIVPAVAIPHPLGNPNL
    SKEDEKKLRRTLVERALKALTTPVDSQTVFEN

    >gi|300871496|ref|YP_003786369.1| putative copper-transporting P-type ATPase [Brachyspira pilosicoli 95/1000]
    MTLKIGGMHCAACSRAVERALKKTDGIEEANVNIATEKAVFNYDEKKLKYDDIVNVVVKAGYQVLGKEEDPAVVKAREIK
    EQKIRLIVSAIFSIPLFYISMAPMVSFVKFPIPSFLVHHINPQVFSIVAIFLCVPVMISGYKFYTLGFPALFRGSPNMDS
    LVAIGTTAAFTYSIYSTVLSFMGLNPHGDNLYYESAAVIITLVQFGKYLEARSKGKTGEAIKKLMGLQPKTATIIKDGEE
    KEIKISDVKVDDIVLVRPGEKIPVDGEIIEGYSSVDESMLTGESIPVEKSVGDKVVGASINKTGSFKFKAQKVGADTALA
    QIIKLVEDAQGSKAPIAHIADVVSSYFVPAVITIALISGIIWFIALHNFVFSLTVFVSVLVIACPCALGLATPTAIMVGT
    GKGAELGILFKNAEALEVSQKINAVMFDKTGTLTEGKPYVTDIISDDKDKLLLIAASAENGSEHPLGEAIVREAKEKNIK
    LLSIENFKAISGFGIETYIDNKKVLMGNDKLMNKENINIENYNSYMDKLSKEGKTPMYVAYDNKLLGIIAVADKLKKESI
    EAINRLHKLGIKTAMITGDNKNTANSVAKEAGIDIVFAEVLPEEKSNEVKKLQEQGFTVAMVGDGINDAPALTQANVGIA
    IGSGTDVAIESADIVLVKSNTNDVVTAIELSKATMRDIKQNLFWAFCYNVIGIPIAAGVLHVFREPLIASSIGGFLTAIM
    GKDLLLNPIFAALAMSLSSVSVVTNALRLNFFKPSK

    >gi|300871508|ref|YP_003786381.1| SoxR-reducing system protein RsxE [Brachyspira pilosicoli 95/1000]
    MCPSLAVTNSVMNAIGMSVATIFVLVCSSALISIVKKIYANEVRIMGYIVVIAAFVTLTDIVMKAKFYTLSLALGPYIPL
    IVVN
    CIILGRAEAFANKNGVIPSIFDALGNGVGFFMALLLLGSIREILGNGTWLGFDIVGTVRGFVESAMPFALNAYNEI
    TTPWIVMILAPGAFFTLGVLIAIKRTIDARVR

    >gi|300871509|ref|YP_003786382.1| NADH:ubiquinone oxidoreductase, RnfA subunit-like protein [Brachyspira pilosicoli 95/1000]
    MNLVLLFVATVLVNNFVLTKFLGICPFLGVSNKLDSAVSMGIAVTFVLVLTAAVSWMIQYYILVPFKIEFLQTILFIIVI
    AALVQFVEMVVRKTSESLYLSLGIYLPLITTN
    CCVLGLALFGVLYKYNFIQNIVFALGAGIGFTLALVIMASIRERLTTA
    NIPEAFKGPAMPFITAGILALIFYGFSGIIKI

    >gi|300871540|ref|YP_003786413.1| rhodanese-like domain-containing protein [Brachyspira pilosicoli 95/1000]
    MENQVNSVNVETAVQLIKTNKDLQLLDIRGPYEVKATGFIEGSMLLDPSDRQIIETIENLDRDKEYLLYCASGGRSFAVS
    QYMLKKGFKHLNNLMNAGYMELSIALENSK

    >gi|300871636|ref|YP_003786509.1| putative thioredoxin reductase [Brachyspira pilosicoli 95/1000]
    MDNIYDLIIVGGGPGGIAAAVEAAILQMKKVLLIEKGDNHSTTIRKFYKDDKRVDKDYKGEALDLKGNIKFETATKGDVL
    DLFSECLFGNYIEAMFNTEVESIKKNGEYLEVATVDNKTYNAKYVVASIGKMGRPNRPDYNIPPSLNNIVNFNIYK
    CKEN
    EKVLVVGGGNSAVEYAYLLGKDNDVTINYRKLEFTRPNEKNLETIKEDIASGKVKPRLGVDIKSIEDSNGKVLVHYTDGI
    DDTYDRVIYALGGVAPIDFLKRCDIELDESGVPIVNDQHESSVKNLFIAGDILYKSGGSIAKALNAGFDIVKHIDELMKK


    >gi|300871670|ref|YP_003786543.1| thiol peroxidase [Brachyspira pilosicoli 95/1000]
    MKITFQGGEVHLEGVSLVEGAKAPDFTGVKTDLSPWSLKDAGDTVKIISSVPSLDTPVCDVQTKRFNKEAASLPGVTVVT
    VSLDLPFAQARWCAAANANSHIVLSDYAERDFGKKFGTLIKELKLLTRAVFVLDKNNVVKYVQYVPEITNEPDYEAAIKA
    AKELL

    >gi|300871902|ref|YP_003786775.1| rhodanese domain-containing protein [Brachyspira pilosicoli 95/1000]
    MKKIIIILSISFLFLACSNKGYKNVNIEKAIKLVNSSTNLVILDVRTREEYLSGNIPNAINIDVLSQDFKSKIDMLDKNK
    EYLIY
    CRSGNRSSIASSIMSTNGFINIYNLENIGYQDFANAMLTNNK

    >gi|300869708|ref|YP_003784579.1| hypothetical protein BP951000_0069 [Brachyspira pilosicoli 95/1000]
    MFKFNIKDKSNYFESQDKAYINPPKRIPFFLRFPIWIASKKVKKDLLLAKILAWNPKTAISSGILESLITHDDKEVSKRL
    LKLIRIQISIDVSCPF
    CIDMNSFEYDKENVTDEEIKALQNKDIDNCISLSKKEKIALKYISAITKTPVVISEELINEVKK
    EYSERAILILVSTAAQVNYWARLIRGLGVPVAGFSNICKLE