Brachyspira murdochii DSM 12563 uid48819

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|296125392|ref|YP_003632644.1| peroxiredoxin [Brachyspira murdochii DSM 12563]
    MSLINKKLIDFKVEAYQNGEFKTVEKKDVLGKWSVFFFYPADFTFVCPTELADLNTVYEDLKKINCEVYSVSADTHFVHK
    AWADATETIKNLKYTMLGDPTGVLGRFFEVYVDEAGQNFRGSFIVNPEGQIKAYEVHDMGIGRDANELLRKVQAAQYVAE
    HGGEVCPAKWKPGAKTLKPGIDLVGKL

    >gi|296125595|ref|YP_003632847.1| electron transport complex, RnfABCDGE type, A subunit [Brachyspira murdochii DSM 12563]
    MVNLILLFVATVLVNNFVLTKFLGICPFLGVSNKLDSAISMGIAVTFVLVLTAAVSWMIQYYILVPFKIEFLQTILFIIV
    IAALVQFVEMVVRKTSESLYLSLGIYLPLITTN
    CCVLGLALFGVLYKYNFIQNIVFALGAGVGFTLALVIMASIRERLMT
    ADIPEAFKGPAMPFITAGILALIFYGFSGIIKI

    >gi|296125596|ref|YP_003632848.1| electron transport complex, RnfABCDGE type, E subunit [Brachyspira murdochii DSM 12563]
    MKNSQVFMEGVWKNNPTFVQVLGMCPSLAVTSSVMNAIGMSAATIFVLVCSSALISLIKKIYANEVRIMGYIVVIAAFVT
    LTDIVMKAKFYTLSLALGPYIPLIVVN
    CIILGRAEAFANKNGIIPSIFDALGNGVGFFIALTLLASIREILGNGTWLGFD
    IVGSIRGFVESAMPFALNAYNEITTPWVVMIMAPGAFFTLGTLIAIKRAIDARGGKANG

    >gi|296125628|ref|YP_003632880.1| Rhodanese domain protein [Brachyspira murdochii DSM 12563]
    MKRNLFIIFTLLLTAVMSNAQTAKNESYELDNIKVVNQNGLALNDFISLLNADPNIVLVDARTPEEIKETGTIKNAINID
    YRAKGYSKKLLSLDKNKKYMFY
    CKSGVRSGRSVQYMLDNGFKNVNYLKDAGYAELSAALK

    >gi|296125823|ref|YP_003633075.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Brachyspira murdochii DSM 12563]
    MKVIVIGCNHAGTWAAKTLKATDPNCQVVTYDRNDNISFLACGIALWVGGVVKDPKGLFYASPESLKAEGIDVYMGHDVT
    KIDWANKKLHVKELKTGKEFDDNYDKLILATGSWPVTPPIEGLMQEGTEYGLKKGIFFSKLFQQGQEIIDEIAKPEVKKV
    MVVGAGYIGVELIEAFKNHGKEVILMEAMPRVMANYFDKEITDEAEKRIKEAGIEMHLGETVKKFEGDDRVKRVVTDKGS
    YDVDMVVMSVGFRPNSELYKDYLETLPNGAIKVDTTMKTTKDPNVFAIGDCATVYSRASGKEEYIALATNAVRMGIVAAN
    NALGKHVEYCGTQGSNAICVFGYNMASTGWSEETAKKKGLKVKSNFFKDAERPEFMPSYEDVLVKIIYEEDTRRMVGAQI
    ASKHNHAEAIHAFSLAIQNGMTVDQFALSDFFFLPHYNKPLSWMTMVAYTAK

    >gi|296125851|ref|YP_003633103.1| Thioredoxin domain protein [Brachyspira murdochii DSM 12563]
    MNKLYLIILCFITFVSCSNSKINWEDDFDKAIEKSKSENKPIMMDIYTDWCGACKEMDKTTFKNKEVSDYTTNFIALKFN
    PEKSSNGDALLKKYNIPGFPTMLFMNSDGFVIKRIIGYIESDELINEMSSIKQKEENIKNAFKDDTPSIEKLDIYIDSGY
    AKESSDMYDILFKENKIPEDSITKYMSKIAVMLLDNDDYENGMRYFNEIIDKYNNQKEVYIAHYYKALDMIINNGQTNEG
    IKYIENLTNEAPEDIKEQYINLIDYFNLSE

    >gi|296125852|ref|YP_003633104.1| protein of unknown function DUF255 [Brachyspira murdochii DSM 12563]
    MNKKILIVLITVLSVVACNKANAEIKWEKDLASAMKKAKEKNLPIMIDVYTDWCTWCKELDKNTYANKEVIDMAKKMVSV
    KLNPETSEEGAEIAQRYGVQGFPTILFISADGFVLENIGGYVEGEKFVPYMKNAIEKLNKINIVLASKEPSLEKLDLYLE
    SGNEEEAKKIYDVLMDRKAISNEAMPKYLLGFGLIKAQKRDYEKANEYFDNIIKNYPKSEEVYVAHYYKVVIMALAGEKD
    EPKKYLEKLIDDPKVPANMKAQYESLLSYINEKN

    >gi|296125890|ref|YP_003633142.1| selenide, water dikinase [Brachyspira murdochii DSM 12563]
    MSNITNNSEENKEQIQLLSCALEGGCSAKIPPDLLEKTLAPIMQTKVDSNLLSDVDIGDDAGVYKISDDNAIIFTVDYFP
    PVIADPYGFGQIAACNAISDIYAMGGEPKLALNITMFPKDDSLNILASILKGGQDKAAEAGVLVVGGHTITDTNVKYGMA
    VVGFANPNKITTNAAAKEGDIIILTKPLGTGACLAAMRQGLIKEEDIKDVFNSMKTLNKKACAVMNKYNVKCATDITGFG
    LIGHSYKMAKASDVTIEIQLSALPMFNKSYEVLDMGCIPGAAFTNMRYVGENILADDDVDYNLKMLSFDPQTAGGLFICA
    DKNNAENILADLWREGIDCASIIGKVHKKEKEYIHLVK

    >gi|296125916|ref|YP_003633168.1| Rhodanese domain protein [Brachyspira murdochii DSM 12563]
    MRKYLLCFALILGFLLMISSCSKNGYDNINMKKALDLISKSTNLVLLDVRTPEEYMSGSAPNSINIDVLNTDFTSKVNLL
    DKNKEYIVY
    CRSGNRSAIASAIMFTNGFLHVYNLANVNYADFVNAVLTNQN

    >gi|296126089|ref|YP_003633341.1| Rhodanese domain protein [Brachyspira murdochii DSM 12563]
    MLKSINVEEAVNLIKSNDDIQLLDVRSQMEIDMGGTIEGSILVDLNDPKSEKLINSLDKEKKYLLYCASGSRSILLGIYM
    DKSGFLKVYNLQNAGYAQLAIALKNI

    >gi|296126124|ref|YP_003633376.1| thioredoxin reductase [Brachyspira murdochii DSM 12563]
    MSVYDSIIIGGGPAGLSAMLYLGRALTNSLLIEKKGAGGQMMSTDTVENYLGFPEEISSFELVAKMQQHAEKFSKNEIVY
    DEVIKIENIKEKIKKVITADGKTYETKTIILAMGGFAKKLGTKGEDTFSAKGVSY
    CATCDGAFYRNKTVAVVGGGNSAFD
    EAYFLTRFVNKIYLVHRRKEFRAEPINVKHLTDTGKVEYVLDSVIDEICGDSKVTSIKIKNVADGSIHEQALDGVFIFVG
    QEPATHFLKDTGIELKESGHIVTNMSTMETNIEGVFACGDSVFKPIRQVANAVGEGAVAAVSATNYLNKA

    >gi|296126284|ref|YP_003633536.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Brachyspira murdochii DSM 12563]
    MQSYDVVIIGGGPAGLAAAVSAKENGIDNLLMLERDEVLGGILNQCIHNGFGLHRFGEELTGPEYAYRFIEKVYDLNINY
    KLNTMVLDIVLNDSKEKIITYINKEEGLVQISSKAVILAMGCRERSRGALNIPGFRPAGIFSAGAAQHLVNIEGYMPGKE
    VVILGSGDIGLIMARRMTFEGAKVKVVAEILPFSGGLKRNIVQCLDDFNIPLKLSHTVIDIKGKDRLEGVTIAKVDENMK
    PIKGTEEYYSCDTLLLSVGLIPENELSKEIGVEINPITSGAIVNESLETNIDGVFSCGNVLHVHDLVDFVSEEAETAGKS
    AAEYVLKNKRRDNTNSISLKGSNGVRYTVPSMINAHNVDDHVMVRFRVSAIFQNKFLNVYFDGERVIHKKHLIFAPGEME
    SVKLDKAMLSKEGLKNIEFKIEDN

    >gi|296126383|ref|YP_003633635.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Brachyspira murdochii DSM 12563]
    MKKIIIIGGVAAGMSAAAKARRLDKEAEITVYEKTDVVSWGACGMPYYVGGFYDNPNTMIARSAEATIKSGINLKVKHEV
    LKIDAKNKKVLVKDIDNNKEFEDSYDSLLIATGAKSIIPNIENINIGNVSTLKDFKDAINMREKMKDENIKNVVVLGAGF
    IAVEAAHALKHTGKNVTMIQRSDRVFGGKFDKEFSDMVIEHIKENIDLRLNEKVLSLEADSNNNVKAVVTDKGRYDADYV
    VVAIGVVPNSDLAKDAGIELMNNGAILVDREAKTSIDGIYAAGDCASIYDRVTDSQTYAALATGANKLGRMSASNLVGGH
    EKFAGSLTSACILAFELEAARTGITEEEAKKRNIDYKTVTVKDLDHTHYYPGYQDLHIKLIYLADSRKIIGGQILGKRGA
    VLRCDVIAACIYAGIPVDELGMLDLCYAPPFARTWDSLNVAGNAAK

    >gi|296126566|ref|YP_003633818.1| heavy metal translocating P-type ATPase [Brachyspira murdochii DSM 12563]
    MKMTLRIGGMHCAACSRAVERALKKTEGIEEANVNIATEKAVLNFDDKKLKYNDIVNVVVKAGYQVVGKEEDPAERKERE
    IKEQKIRLIVSAVFSIPLFYISMAPMVSIVKFPIPSFLVHHINPQVFSIAAILLCVPVMISGYKFYTLGYPALFRGSPNM
    DSLVAIGTTAAFVYSVYSSILAFIGLNPHGENLYYESAAVIITLVQFGKYLEARSKGKTGEAIKKLMGLQPKTATIIKDG
    EEKEIKISEVKVDDIVLVRPGEKIPVDGEIIEGYSSVDESMLTGESIPVEKSVGDKVVGASINKTGSFKFKAQKVGADTA
    LAQIIKLVEDAQGSKAPIAHIADVVSSYFVPAVITIALISAVIWFIALHNFVFSLTVFVSVLVIACPCALGLATPTAIMV
    GTGKGAELGILFKNAEALEVSQKINAVMFDKTGTLTEGKPYVTDIISDDKDKLLLIAASAENGSEHPLGEAIVREAKEKN
    IKLLDIENFKAIAGFGIEVFIDNKKVLMGNDKLMNKENINTESYHSYMESLSKDGKTPMYVAYDNKLLGVIACADKLKKE
    SIDAIRRLHKLGIKTAMITGDNKNTANSVAKEAGIDIVFAEVLPEEKSKEVKKLQDEGNIAAMVGDGINDAPALTQANVG
    IAIGSGTDVAIESADIVLVKSNTNDVVTAIELSKATMRDIKQNLFWAFCYNVIGIPIAAGVLHVFREPLIASSIGDFLVA
    IMGKDLLLNPIFAALAMSLSSVSVVTNALRLNFFKPSK

    >gi|296127070|ref|YP_003634322.1| redox-active disulfide protein 2 [Brachyspira murdochii DSM 12563]
    MSSEKNCCCGGSSSNARIKILGSGCSNCQKLEKNALEAVKEIGIDLSVGHVQDMAQIASYGVMSTPALVLDEKVLSYGKV
    LTKDEIIALLKDKVK

    >gi|296127132|ref|YP_003634384.1| Rhodanese domain protein [Brachyspira murdochii DSM 12563]
    MKKFLFLLILILSVLASCSKTETNSNTNQSSVNASPVEKTRVYVNADWVKSVIDGNQPQSSNYVILEASWGDASADYKKA
    HIPGALHINTDLIEEPEYWNVRTPKEIEQVMKDFGISKDTAVIVYGEPSPAARVATTLLWAGVDEVHVLDGNLKAWTDMG
    YAASSNTEKAKPIDDVGVIVPAHPEYIISLPEQIIEKQKDPNFKLVSIRSWDEFTGKVSGYSYIERVGEPKGAVWGRDEF
    DYVDDNGKIISIDEAQKIWNEWGVTKDNEISFY
    CGTGWRAAIPFLIAYQEGWTNVTLFDGGWYVWQMNPELPVQLGDPRE
    NTNN

    >gi|296127168|ref|YP_003634420.1| Peroxiredoxin [Brachyspira murdochii DSM 12563]
    MSIYDYTVKDAEGKDISLKEYEGKVLLIVNTATKCGFTKQYSELQNLYTKYQKEGFEILDFPCNQFGGQAKEPIEEIAEF
    RKEKYGITFKLFDKVKVNSKNADPLFTYLRTEKPTEEGVEKIRWNFGKFLIDRQGNIVGRYDPRVKPEELDEIVGELLKK


    >gi|296127169|ref|YP_003634421.1| Redoxin domain protein [Brachyspira murdochii DSM 12563]
    MTVTFQGATQTLEGAQLSVGAKALDFTVLKTDLSPWSLKDAGDTVKIISSVPSLDTPVCDVQTRRFNKEAANLKGVTVVT
    ISVDLPFAQARWCGAANVSSHIVASDYNQKDFGRKFGTLLKELQLLTRAVFVLDKDNVVKYVQYVPEITNEPDYDAALNA
    AKALL

    >gi|296127189|ref|YP_003634441.1| Rhodanese domain protein [Brachyspira murdochii DSM 12563]
    MNNTLTLIIGLVITFIVLSFVRKIIFNIMSKGKFKNININEAASLYKNNKNIGLIDVRSYAEVQQSGYIKNSVNIPLDDS
    KFNEKMSKLDKNKEYIVY
    CASGSRSGMASMRMYKLGFTNINNLRGAGYFQLSSVLK

    >gi|296127401|ref|YP_003634653.1| Protein-disulfide reductase [Brachyspira murdochii DSM 12563]
    MNNNQFKVLKYIIILIFVTAYTSFAQNNNLMNLNAFDRLDKNAEISFTLITNNNQLAVKANIPNNYYAYLESAVANKILF
    FADNKQINTIYPEGEKYHNDIIIKGDTEFILEDVDINKINFIKCTYQLCSEKDNVCLQPQSKVIYGEEIDIQNNNIADEK
    PENASSIENYIKGSNNIFITLILIFAAGLASVLLPCTYPLLSITVSILGTTTDNKNNKKSSVLASLLFALGVITTYTLLG
    AVVSVAGFAFHKTILFGSIGYNPIILTILVLLFLYFTFSMAGFYEIKAPSFLQSAKTNAYSKKNQSLFHKYIMGLLAGIV
    ATPCAAPIIAVILEIGFLNPVFAALYMAVYALGFASVLFVLGTFASILTKMPKAGTWMVYVKYIFTFLMMIISFYYANIL
    FGVLGFNKISYILSSVTILIFAVLVYIIKNKSAMLSALELKIFVSVVIISIALGSAYGFIKSKSEVSNHITYTEALELSK
    QNNKPILIDFSAVW
    CANCYELKDKVFVNEELKKFIDDNLIFTEVDVDKYKNISDEYNVKWLPWIIVIDSNKNILYTKNSF
    SSFDDEMALTIKKDLEKIINK

    >gi|296127422|ref|YP_003634674.1| protein of unknown function DUF156 [Brachyspira murdochii DSM 12563]
    MVIENGLNIVSPSEAGEIIKNTANVVILDVRTEMEHNYEGMIEDSVSMDFLKPRAFKREISKLDKNTPYLLYCSIGKLSI
    KAAEYMKEEGFNNIYVLEGGLKAWNKHFGDSNKVSKFDREEAVERRKRLIIRLNRIEGQINGMKKMLAKGEYCGDILNQS
    LAVKAAMGSVNQEIMEVFLNTCMISPKEKEDFFRYMRKLIK

    >gi|296127423|ref|YP_003634675.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Brachyspira murdochii DSM 12563]
    MKKILIVGGVAGGASAAARLRRLNEEDKIIMFEKGPHVSFSNCSLPYHIGGLIPNEETLLLMNPEKFLKQFNVDARINSE
    VVAIDREKKEVTVVAEGREYKESYDKLILSMGAKPIVPPFKGMDKVNVFTVRNVVDISKIHNFLNGKPNAKVTVIGGGFI
    GIEMAENLKKAGYDVTIVEALPQIMKPFDYDMVQILHRELIDNGVDLIVNDKVDSFDTNTVILGSGKKIEADAVILAIGV
    APETDIAVKAGIELGKTKAIKVDANYRTNDKDIYAVGDAIEVYSPLFNDYFKLALAGPAQKQARAVADHINGRTVDNRGF
    IGSSVIKVFGYNGASTGLSEGLIKAMNLNIDYDTVEIIPFDGVSIMPSARLLHFKLIYEVPTGKVLGAQAIGKGNVDKRI
    DVIAALIKFGGTIDDLKDLELCYAPSFGTAKDAVNFAGYVASNLRNGDFKQVHFSQVRELVEKDAYFLDVRPPEDFAVGH
    LEKAVNIPLGALRSRYNEVPKDRPVYIT
    CKTGLTSYTACKILQNIGFNNVINVSGGFVGLSQYEYYNDKVTGRKPILTGY
    FK

    >gi|296127630|ref|YP_003634882.1| Radical SAM domain protein [Brachyspira murdochii DSM 12563]
    MHFSEMLKKYSIKLNKKEIKTIQINTGYGCNLNCTHCHVDANKNRTETITKEVIDDCLKFIKNCGKEIDIDITGGAPEKS
    EFIEYFIKELRKLKNVKRIILRTNLTILEDKKELIDVFKENNVELTASLPCYTKENVDEQRGNGTYEKCINMLKYLNSIG
    YGIDKNLIINLVYNPLDDYLPSSQKELEKDYKINLKNDHNIVFNNLYTIANIPIGRFEEKLKKNNKYEAYMKLLEDNFNA
    SNAFKVMCLDTINIGYDGNVYDCDFNQMKNLLSQNGKSYYIGDLTIDDFKDNNIPVEDYCYGCTAGEGSS
    CQGNLS

    >gi|296127631|ref|YP_003634883.1| Rhodanese domain protein [Brachyspira murdochii DSM 12563]
    MKKNLIITFTLLSVILLMAGCQKKETSEAVNYKNLTVDEAAALIVSNPDIILIDVRTPDEIKETGTIENSSNIDFKAADF
    KEKVSTLDKSKEYLLF
    CRTGNRSGQASQIMADLGFTNINNLKDAGYDEFSKALAK

    >gi|296127677|ref|YP_003634929.1| thioredoxin [Brachyspira murdochii DSM 12563]
    MSVQELKSDNFEGSISGDKAILVDFFAEWCGPCKMQTPILHKIADQYSDKMNFGAVNVDEAEDIAAKYGVQSIPTLIVFK
    GGEIVKRAEGMKNEAQLKEWLKDYL

    >gi|296127698|ref|YP_003634950.1| methylated-DNA/protein-cysteinemethyltransferase [Brachyspira murdochii DSM 12563]
    MNIIRLDKKEDSKKAYIYKSPIGDLIITSDDDCQYITSLTFDLNDNQTIIKDEEPAIIKRVKKELDNYFTKNSRTFTIDL
    GVYGTDFQYNVWIETSKIPFGKVLTYSDIAKNISDKKGSISRAVGTAEGKNSIAIIIP
    CHRVVGSNRKLTGYAGGLDKKE
    YLLSHEGFNIVGFKIIP

    >gi|296127735|ref|YP_003634987.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Brachyspira murdochii DSM 12563]
    MSNLYDCIIIGGGPSGLAAGIYSARARLKTVLFEKGSFGGQISITDEIANYPGFYEASEEGRHPKNLINKMIEQAKTFGA
    EIEHKEVTDVKLDGKIKEVTLSDGTVYQSKVVIIATGAQPRKLGCKGELEYTGKGVSY
    CATCDANFFEGMEVFCIGGGDT
    AVEEAMYLSKFARKVTLIVRKDYVRCANSIEEKAKANPKIEIKFRTELLELKGDGIVESAIFLNNETGEKYEYKADEEDG
    TFGVFIFVGYVPLTKLFEGKVAMQDGYILTDEEMKTNVEGVFACGDLRPKMLKQVITAAADGAIAGISANKYIEEKFAE

    >gi|296127745|ref|YP_003634997.1| Peptide-methionine (R)-S-oxide reductase [Brachyspira murdochii DSM 12563]
    MEKRELTEEEKNVIIFKGTEYPFTGKYNDFFEEGVYCCKQCGAELYRSEDKFKSHCGWPSFDDEIKGSVRRSLDEDGYRI
    EITCSNCGGHLGHVFQGEHFTEKNTRH
    CVNSISLIFKPKK

    >gi|296127763|ref|YP_003635015.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Brachyspira murdochii DSM 12563]
    MDNKYNLIIVGGGPGGIAASVEASILKMDKVLLIEKGDNHSTTIRKFYKDDKRVDKDYKGEALDLKGNIKFETATKGDVL
    DLFSECLFGNYIEAMFNTEVESIKNNGEYLEVTTVDNKQYEAKYVVASIGKMGRPNRPDYAIPASLNAVVNFNIYK
    CKEN
    EKILVVGGGNSAVEYAYLLGKDNDVTINYRKAEFTRPNEKNLETIKEDIASGKVKARLGVDIKSIEDKDGKVLVHYTDGV
    DEVYDRVIYALGGVAPVDFLKRCDIELDEAGVPIVNDKHESSVKNLFIAGDILYKSGGSIAKALNAGFDIVEHIDSLMKK


    >gi|296127790|ref|YP_003635042.1| Thioredoxin domain protein [Brachyspira murdochii DSM 12563]
    MEELNKDNFDEKVINSKDLCLVDYFGDTCEPCKALMPHVHELAKEYEGKVPFYSFNTSKARRLAIREKILGLPTIAVYKD
    GAKVKEVTKEEATIENIKAMVDSML