Brachyspira hyodysenteriae WA1 uid59291

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|225619135|ref|YP_002720361.1| alkyl hydrogen peroxide reductase [Brachyspira hyodysenteriae WA1]
    MSLINKKLIDFKVEAYQNGEFKTVETKDVLGKWSVFFFYPADFTFVCPTELADLGTVYDELKKINCEVYSVSEDTHFVHK
    AWADATPTIKNLKYTMLGDPTGVLAKFFEVYVEEEGKALRGSFIVNPQGEIKAYEVHDMGIGRDANELLRKVQAAQYVAE
    HGGEVCPAKWKPGASTLKPGIDLVGKL

    >gi|225619159|ref|YP_002720385.1| methylated DNA-protein cysteine methyltransferase [Brachyspira hyodysenteriae WA1]
    MKIIRLEKKSNFSKAYIHKSPIGDLILTADETYKYITSLEFNLNNIKVSSNNEEPSIIKQAKKELDDYFSNGLKKFSLPL
    AIYGTDFQYNVWMETSKIPFGKVVTYSDIARNISDKKGSISRAVGTAEGKNKIAIIIP
    CHRVVGVNKKLTGYAGGLDKKE
    YLLKLEGFNIVNSKIIIE

    >gi|225619480|ref|YP_002720737.1| iron compound ABC transporter, periplasmic iron compound-binding protein [Brachyspira hyodysenteriae WA1]
    MKTVRIFLFIFFSIFLFSCSNADKSNNILSIKDRAGNDIILPEKIENIACLSPSVTDIILSLGLADKIIAFDSTSKEILY
    TNNIDVSNISVFDMLNPDSEKIIAMKPDIVFVNNFSVFSGKTSLDSIKASGI
    CVAVIPSSDTIKSIEDDINFLGNVLDKS
    DAASNIINIMNKNIENIRTIGESIQNKKKVYFEIAALPNLYSFGTNVYIDDMINIIGASNVFSDKNSWISTSEENILFSN
    PDIIFTSVNYIDNPTEEILKRKSWQNINAVKNKDVYYIASSSLPTHNIINAMIMMAKYAYPNEYKDIEIIRN

    >gi|225619524|ref|YP_002720781.1| methionine sulfoxide reductase B [Brachyspira hyodysenteriae WA1]
    MEKRELTEEERNVIIFKGTEYPFTGEYNDFFEEGVYCCKQCGAELYRSEDKFKSHCGWPSFDDEIEGAIRRTLDEDGYRI
    EITCNSCGGHLGHVFEGEHLTEKNTRH
    CVNSISLIFKPKK

    >gi|225619545|ref|YP_002720802.1| thioredoxin reductase [Brachyspira hyodysenteriae WA1]
    MDNKYDLIIVGGGPGGIAASVEASILEIKKVLLLEKGDNHSTTIRKFYKDDKRVDKDYKGEALDLKGNIKFETATKGDVL
    DLFSECLFGNYIEAMFNTEVESIKKNGEYLEVNTSDNKQYLAKYVVASIGKMGRPNKPDYAIPASLNNVVNFNIYK
    CKEN
    EKVLVVGGGNSAVEYAYLLGKDNNVTINYRKAEFTRPNEKNLETIKEDISSGKVKAKLGIDITSIEDKEGKVLVHYTDGT
    EDTYDRVIYALGGVAPVDFLKRCNIELDANGVPIVNENHESSVQNLFIAGDILYKSGGSIAKALNAGFDIVKYIHDLIKK
    SGN

    >gi|225619907|ref|YP_002721164.1| RnfA, Predicted DH:ubiquinone oxidoreductase, subunit RnfA [Brachyspira hyodysenteriae WA1]
    MVNLILLFIATVLVNNFVLTKFLGICPFLGVSNKLDSAISMGIAVTFVLVLTAAVSWMIQYYILVPFKIEFLQTILFIIV
    IAALVQFVEMVVRKTSESLYLALGIFLPLITTN
    CCVLGLALFGVLYKYNFIQNIVFALGAGVGFTLALVIMASIRERLMT
    ADIPEAFKGPAMPFITAGILALIFYGFSGIIKI

    >gi|225619908|ref|YP_002721165.1| SoxR-reducing system protein RsxE [Brachyspira hyodysenteriae WA1]
    MKNSQVFMEGVWKNNPTFVQVLGMCPSLAVTSSVMNAIGMSVATIFVLVCSSALISLIKKIYANEVRIMGYIVVIAAFVT
    LTDIVMKAKFYTLSLALGPYIPLIVVN
    CIILGRAEAFANKNGIIPSIFDALGNGVGFFIALTLLASIREVLGNGTWLGFD
    IVGTLRGFFESAMPFALNAYNEITTPWVVMIMAPGAFFTLGTLIAIKRAIDARGGKANG

    >gi|225619927|ref|YP_002721184.1| peroxiredoxin family, thiol peroxidase [Brachyspira hyodysenteriae WA1]
    MTVTFQGATQNLEGSQLTVGAKALDFTVLKTDLSPWSLKDAGDTVKIISSVPSLDTPVCDVQTKRFNKEAASLKGVTVVT
    VSVDLPFAQARWCAAANADSHIVASDYNQKDFGRKFGTLLKELQLLTRAVFVLDKDNVVKYVQYVPEITNEPDYDAALNA
    AKALL

    >gi|225619950|ref|YP_002721207.1| rhodanese-like domain protein [Brachyspira hyodysenteriae WA1]
    MKRNLFIIIALLLTTIVCNAQTAKTNEAVYELDNVKVVNKNGLALNDFISSWKADPNIILVDVRTPQEIKETGTIKGAMN
    IDYRAKGYSKKILSLDKTKKYFFY
    CKSGGRSGKTVQYLLDNGFKNVNYLKDAGYSELNAALKK

    >gi|225619964|ref|YP_002721221.1| thiol-disulfide interchange protein [Brachyspira hyodysenteriae WA1]
    MNIKILRYIIITIFITAYISFAQNNNLLNLNQFDSLNKNPEINFSLDTNNNKLIVKAIIPNNYYAYLESKIANKILFFAD
    NKEINVIYPEGEKYHDDTIIKGEQEFILNNIDINKINFIKATYQLCSAKDNVCLQPQSKVIYGEEIDIPNNANIITDEKP
    ENATSIENYIKGSDNIFITLILIFAAGLASVLLPCTYPLLSITVSILGTTTDSKNNKKSSVLASLLFALGVITTYTLLGA
    VVSVAGFAFHKTILFGSIGYNPIVLTILVLLFLYFTFSMAGFYEIKAPSFLQSAKTNAYAKKNQSIFHKYIMGLLAGIVA
    TPCAAPIIAVILEIGFLNPVFATLYMAVYALGFASVLFILGTFASILTKMPKAGTWMVYVKYIFTFLMMIISFYYANILF
    GVIGFNKISYILASVTILVFAVLVYIIKNKSAMLSALEIKIFVSVVIISITLGSAYGFIKQKNEVSNMISYNEALELSKQ
    NNKPILIDFSAVW
    CANCYELKEKVFVNEELKKFIDDNLIFTEVDVDKYKNISDEYNVKWLPWIIVIDRDKKILYTKNSFS
    SFDDKMALSIKEELEKVINK

    >gi|225620044|ref|YP_002721301.1| bifunctional methionine sulfoxide reductase [Brachyspira hyodysenteriae WA1]
    MLRNAIILISILIFTISCDENNTKEVCNVCNETKTLSAKEYHVLINKGTETPFTGDLLNIKEDGIYTCKICDTPLFRSEA
    KFNSGTGWPSFDDAIKENIKLVPDGDRIEVVCAKCGGHMGHVFYGEGFTEKETRY
    CINSVSLNFVNKFTNENNNENSEYK


    >gi|225620045|ref|YP_002721302.1| bifunctional methionine sulfoxide reductase [Brachyspira hyodysenteriae WA1]
    MIKKTIITILSLLSIISCSQKLNSQNINDKGNNMNNNTAIPENVKYAYFSSGCFWGTEYWFEKSKGVISVVSGYAGGHKV
    NPTYQEVCTGLTGHLETVRVAYDPEKTTYEELVKLFFETHDFTQKNGQGPDIGSQYLSAIFYQNDEEKETAEKYVAMLRE
    KKYDVATTIRPFKNFYGAEDYHQNYYARKGSMPYCHFYTKIF

    >gi|225620113|ref|YP_002721370.1| PRK00943: selenophosphate synthetase [Brachyspira hyodysenteriae WA1]
    MSNITNNTEEKKEQIELLSCALEGGCSAKIPPDLLEKTLTPLMQIKKDSNLLSDVDIGDDAGVYKISDDNALIFTVDYFP
    PVIADPYGFGQIAACNSISDIYAMGGEPKLALNITMFPKDDSLNILANMLKGGQDKATEAGVLVVGGHTITDASVKYGMA
    VIGFANPNKITTNAAAKEGDIIIFTKPLGTGACLAAMRQGLIKESHIEDVFESMKTLNKKACAVMNKYNVKCATDITGFG
    LIGHAYKMAKASDVTIEIQSSALPMFNKTYEVLDMGCIPGAAFTNMRYVGDNIKVDDNVDYNLKMLSFDPQTSGGLFICA
    DKSNAENILADLWREGIDCACIIGKVKNKEKEYIHLIK

    >gi|225620163|ref|YP_002721420.1| rhodanese domain protein [Brachyspira hyodysenteriae WA1]
    MSLLFVFSCSKKPYDNINLKKALDLMSKSTNLVLLDVRTAEEYMGGSAPNSINIDVLNTDFKSKIDLLDKNKEYIVYCRS
    GNRSSIASSIMATNGFLHVYNLQNISYADFVNAILTNQN

    >gi|225620442|ref|YP_002721699.1| Rhodanese-like protein [Brachyspira hyodysenteriae WA1]
    MLKSLNVQEAADLIKSGNDIKLLDVRSKMEVNMTGAIEGSILIDLNDPISEKLVNDLDKSGKYLLYCATGARSEALAHYM
    DRNGFKEIYNLIYAGHSQLAMALAK

    >gi|225620657|ref|YP_002721915.1| ZntA, Cation transport ATPase [Brachyspira hyodysenteriae WA1]
    MKMTLKIGGMHCAACSRAVERALKKTEGIEDANVNIATEKAVFNYDDKKLKYDDIVNVVVKAGYQVLGKEEDPAVVKARE
    IKDQKIRLIVSAIFSIPLFYISMAPMVSFIKFPIPSFLVHHINPQVFSIVAIFLCVPVMISGYKFYTLGFPALFRGSPNM
    DSLVAIGTTAAFTYSIYSTVLAFMGLNPHGENLYYESAAVIITLVQFGKYLEARSKGKTGEAIKKLMGLQPKTATIIKDG
    EEKEIKIADVKVDDIVLVRPGEKIPVDGVIIEGYSSVDESMLTGESIPVEKSVGDKVVGASINKTGSFKFKAQKVGADTA
    LAQIIKLVEDAQGSKAPIAHIADVVSSYFVPAVITIALISGIIWFIALHNFVFSLTVFVSVLVIACPCALGLATPTAIMV
    GTGKGAELGILFKNAEALEVSEKINAVMFDKTGTLTEGKPYVTDIISDDKDKLLLIAASAENGSEHPLGEAIVREAKEKN
    IKLLNIENFKAIAGFGIEVFIDNKKVLMGNDKLMNKENINTENYNSYMDKLSKEGKTPMYVSYDNKLLGIIAVADKLKKE
    SIEAINRLHKLGIKTAMITGDNKNTANSVAKEAGIDIVFAEVLPEEKSNEVKKLQDQGLTVAMVGDGINDAPALTQANVG
    IAIGSGTDVAIESADIVLVKSNTNDVVTAIELSKATMRDIKQNLFWAFCYNVIGIPIAAGVLHVFREPLIASSIGGFLTA
    IMGKDLLLNPIFAALAMSLSSVSVVTNALRLNFFKPSK

    >gi|225620923|ref|YP_002722181.1| coenzyme A disulfide reductase [Brachyspira hyodysenteriae WA1]
    MKKVIIIGGVAAGMSAAAKARRIDKEAVITVYEKTDVVSWGACGMPYYVGGFYESPNTMIARSAEATIKSGIDLKIKHEV
    LKIDAKNKKVLVKDIVNNKEFEDNYDSLLIATGAKSIIPNIPNINIGNVSTLKDFSDSINMREKMKDTNIKNVVILGAGF
    IAIEAAHALNHIGKNVTIIQRSDRVFGNKFDKEFSDMVIEHIKENVDLHLNEKVQSLEADNNNNVKAVITDKGKYDADYV
    VVAIGVTPNNDLAKEAGIKLMDNGAILVDREGKTSIDSIYAAGDCASIYDRVLDDQTYAALATGANKLGRMVASNLVGGH
    EKFIGSLTSACILAFELEAARTGITEEEAKKRNINYKTVTVKDLDHTHYYPGYQDLHIKLIYLADSRKIIGGQILGKRGA
    VLRADVIAACIHAGLTVDELGMLDLCYAPPFARTWDSLNVAGNAAK

    >gi|225620991|ref|YP_002722249.1| thioredoxin reductase [Brachyspira hyodysenteriae WA1]
    MSVYDSVIIGGGPAGLSAMLYLGRALTNSILIEKKGIGGQMMSTDAVENYLGFPEEMSAFELVARMQQHAEKFSKNEIVY
    DEVIKVENIKDEVKKVITADGNTYETKTIILAMGGFAKKLGTKGEEAFGGKGVSY
    CATCDGAFYRNKTVAVVGGGNSAFD
    EAYFLTRFVNKIYLVHRRKEFRAEPINVKHLTDTGKVEYVLDSVIDEICGDGKVNSIKIKNVVYGSIHDQAVDGVFVFVG
    QEPATHFLKDTGLELKDTGHIVTDMSTMETNIPGVFACGDSILKPVRQVANAVGEGAVAAMSVTHYLNKA

    >gi|225621151|ref|YP_002722409.1| hypothetical protein BHWA1_02249 [Brachyspira hyodysenteriae WA1]
    MFFNNNKKSQCSCGGSCQTSSEENARIKILGTGCNNCRKLKENTLKALKDMGLNLTVGHVYDIEKIASYGVISTPSLVLD
    ENVLSYGKVLNKDEIIELLKDKL

    >gi|225621242|ref|YP_002722500.1| glutathione peroxidase [Brachyspira hyodysenteriae WA1]
    MNIYDYTVKDINGSDISLSKYKNKVLLIVNTATRCGFTKQYKDLENIYKMYNSRGFEILDFPCNQFLNQAPESDDEINNF
    CKLKYNTTFDRFKKIDVKGKNIEPLYSYLINNSNYLFNKDIKWNFTKFLIDRNGNIVRRFSSFSSGNTITKYIDKLI

    >gi|225621390|ref|YP_002722648.1| DH oxidase [Brachyspira hyodysenteriae WA1]
    MKVIVIGCNHAGTWAAKTLKATDPNCQVVTYDRNDNISFLACGIALWVGGVVKDPKGLFYASPESLRGEGIDVYMGHDVT
    KIDWANKKLCVKELKTGKEFEDTYDKLILATGSWPVTPPIEGLKQEGTTYGLKKGIFFSKLYQQGQEIIDEIAKPDVKKV
    MVVGAGYIGVELIEAFKNHGKEVILMEAMPRVMANYFDKEITDEAEKRIKEAGIEMHLGETVKKFEGDDRVKKVVTDKGS
    YDVDMVVMSVGFRPNNELYKDYLETLPNGAIVVDTTMKTTKDPDVFAIGDCATVYSRASEKQEYIALSTNAVRMGIVAAN
    NALGKHVEYCGTQGSNAICVFGYNMASTGWSEETAKKKGLKVKSNFFKDSERPEFMPTNEDVLVKIIYEEGSRRLLGAQI
    ASKHNHAEAIHAFSLAIQNGMTVDQFALSDFFFLPHYNKPLSWMTMVAYTAK

    >gi|225621408|ref|YP_002722667.1| putative Rhodanese Homology Domain (RHOD) superfamily protein [Brachyspira hyodysenteriae WA1]
    MNNTLTLIIGLILTFIILSAVRKIIFNIRSKGKFKNININDAVSIYKNNKDVGLIDVRSYMEVQQSGYIKSSVNIPLDDS
    KFDEKMSKLDKNKEYIVY
    CASGSRSGMACMRMYKLGFTNINNLTHAGYFQLSSYLK

    >gi|225621501|ref|YP_002722760.1| pyridine nucleotide-disulphide oxidoreductase [Brachyspira hyodysenteriae WA1]
    MKKILIVGGVAGGASAAARLRRLNEEDKIIMFEKGPHVSFSNCSLPYHIGGLIPNEETLLLMNPEKFLKQFNVDARVNSE
    VVAIDRKNKEVTVVSEGREYKESYDKLILSMGAKPIVPPIKGIEKVNVFTVRNVVDISKIHNFLKGKSNAKVSVIGGGFI
    GIEMAENLKKVGYDVTIVEALPQIMKPFDYDMVQILHREIMDNGVNLIVNDKVDSFDTNTVILGSGKKIEADAVILAIGV
    SPETDIAAKAGIELGKTKGIKVDSTYRTNDKDIYAVGDAIEVYSPLFNDYYRLPLAGPAQKQARAVADHINGRTVDNRGF
    ISSSVIKVFGYNGASTGLSEGFIKAMNLNIDYDTVEIIPFDGVSIMPTARLMHFKLIYEVPTGKVLGAQAIGKGNVDKRI
    DVIATIIKFGGTIDDLKDLELCYAPSFGTAKDVVNFAGYVASNLRNGDYKQVHYSQVRELVEKDAYFLDVRMPEDFAVGH
    LEKAVNIPLGALRSRYNEIPKDRTVYIT
    CKTGLTSYTACKILQNIGFNNVVNVSGGFIGLSQYEYFNDKTTGRKPILTGY
    FG

    >gi|225621502|ref|YP_002722761.1| putative Rhodanese Homology Domain (RHOD) protein [Brachyspira hyodysenteriae WA1]
    MLIENDLKILSPSEAGEIISNTDNIVILDVRTEMEHNYEGMIEDSISMDFLKPRVFKREISKLDKETPYLLYCSIGKLSI
    KAAEYMKEEGFKNLYILEGGLKAWNKHFGDNNKVSKFDREEAVERRKRLIIRLNRIEGQIKGMKKMLAKGEYCGDILNQS
    LAVKAAMGSVNQEIMEVFLNTCMISPKEKEDFFRYMRKLIK

    >gi|225621512|ref|YP_002722771.1| thiol-disulfide interchange protein DsbD-like protein [Brachyspira hyodysenteriae WA1]
    MNKLYIIIFSFVLLVSCSNAGKINWESDFDVSVEKSKSENKIIMMDIYTDWCGACKEMDKTTFKNKTVIDSSTNFIALKF
    NPEKMSNGKDILKKYNILGFPTMLFINSDGFILKRIVGYIESDELINEMNGMKERNDRVKVIFKDDSASLDKLDIYLESG
    YDNEALDMYNKLTSESKIPEDKMAKYMSSIALLLLDNNKLEEGMKYFDEIISKYSNYNEVYIAHYYKALDMIVNNAQTNE
    GIKYIENLTNQVPDGIKNEYLDFIDYFSSN

    >gi|225621513|ref|YP_002722772.1| thiol-disulfide interchange protein DsbD-like protein [Brachyspira hyodysenteriae WA1]
    MNKNILMILFIMFTSIISCNKASAEIKWEKDLATAMKKAKEKNLPIMIDVYTDWCTWCKELDKNTYSHKDVIDVAKKMVS
    VKLNPETSEEGAEIAQRYGVNGFPTILFISADGFILENVGGYVEGEKFVPYMKNAIEKLDRVNSVLANKEPTLEKLDLYM
    ESGNEVESQKIYDALMQKKAISKEKMPKYLLGFGLIKAQKKDYDNANKYFDDIIKNYPNSEEVYIAHYYKAVIMALAGEK
    DEPKKYLEKLINDPKVPEDMKNQYENLLSYINETN

    >gi|225621535|ref|YP_002722794.1| thioredoxin [Brachyspira hyodysenteriae WA1]
    MSVQELKTDNFEAAIGGDKAILVDFFAEWCGPCKMQTPVLHKVADQYADKMNFGAVNVDEAEEVAAKYGVQSIPTLMVFK
    GGELVKRAEGMKNEAQLKEWLKEYL