Acidothermus cellulolyticus 11B uid58501

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|117927270|ref|YP_871821.1| thiosulfate sulfurtransferase [Acidothermus cellulolyticus 11B]
    MSRQQVLVDADWVEAHLNDPNVVVVEVDEDTSAYDKGHIRNAVKLDWKKDLQDPVRRDFVDKAAFERLMSERGISNDHTV
    VLYGGNNNWFAAYAYWYFKLYGHRDVKLLDGGRKKWELESRELTQEVPVRPRTTYVAKDPDTSIRAFRDEVVNSIGKLNI
    IDVRSPDEFSGKLLAPAHLPQESAQRPGHVPTAKNVPWSKAANDDGTFKSDEELRKLYAEAGVDFSKDTIAY
    CRIGERSA
    HTWFVLHELLDQPNVKNYDGSWTEYGSLVGVPIELGSGS

    >gi|117927450|ref|YP_872001.1| glutaredoxin 2 [Acidothermus cellulolyticus 11B]
    MTVGASAAGTPHVVLLSKPGCHLCDEARVIVAAITAEFGIGFVERDIRADPEDLREYGELIPVVLVNDIEVGHWRITADQ
    LRAALRAGSSRPA

    >gi|117927460|ref|YP_872011.1| redoxin domain-containing protein [Acidothermus cellulolyticus 11B]
    MAIWQYMHDQPGAGRRGCSGRRFFTQGFRSLVACCVVVLLAGCAASRAADSTTVVNGKAAITRFAAGDRPAAPMVSGTDL
    SGRPLSLAQFRGTVIVLNFWASW
    CPPCRSEAAALEQVYTETKALGVHFVGVDIRENGPNDGPAFVADHHISYPSFADPSA
    SIALQFRGSGINPALPPSTLVIDRSGRIAARALGELTYNPLKALVLDVVRESS

    >gi|117927603|ref|YP_872154.1| flavoprotein disulfide reductase [Acidothermus cellulolyticus 11B]
    MTRVVIIGGGPGGYEAALVAAQLGATVTVVERSGLGGACVLTDCVPSKTLIAAAEQVSGVERTGAEEWTTCRYGAPDFAV
    LNQRIRDLARAQSRDIAERLAGEGVDVITGTGRLVAEVGRGHRVAVRHGTGESVLEADVVLLATGARPRQLPAAVVDGER
    ILTWHQLYDLQAVPEHLIVVGSGVTGAEFAGAYLALGASVTLVSSRDRVLPNEDPDAAAVVEDVFRRRGMVVANRSRAAS
    VHRTNDGVLVTLTDGRRIEGSHCLLAVGSVPNTEDLGLSEVGVATTSAGFVQVDRVSRTTVPGIYAAGDCTGVLMLASVA
    AMQGRIAMWHALGESVRPLRTSTVAATVFTAPEIASVGVTAQAVASGAVDGRAVTVPLARNPRAKMSGIVDGFVKLFARK
    VTGVVLGGVVVAPKASELILPVSMAVSVGLTVDELAQTFSVYPSLSGSITEAGRALMNAIWDD

    >gi|117927705|ref|YP_872256.1| alkylhydroperoxidase [Acidothermus cellulolyticus 11B]
    MPHDVYPPATDAMSRRRRELAPEIHDAFTAFSRQVFADGALPEVTKQLIAVAVAHTTQCPYCIRGHTTLARRKGASDQQI
    MEAIWVAAEMRAGGAYAHAAVALDALAAGESTGS

    >gi|117927749|ref|YP_872300.1| OsmC family protein [Acidothermus cellulolyticus 11B]
    MTAEVTRAATDFGRAATDFGRVEISHVTGDRFTVRIRDHAVTVDQPKDAGGEDTGPTPTELFVASLAGCVGFYVRRALAR
    RGHPTDGLAVTTTYRMGTNPARVAEVRITVALPGDYDADTLARLRAVAEH
    CTVHNSLRIPPSIEVELATTP

    >gi|117927750|ref|YP_872301.1| thioredoxin [Acidothermus cellulolyticus 11B]
    MSTVNLTEETFADAVQRPGITLIDWWAAWCGPCRSFAPVYEAASTRHPDIVFAKVDVDAQPRLAGQFGIASIPTLMAFKD
    GNLVFAQPGALPPAILERLISAVRELDLTKAAVDAADAEGSRG

    >gi|117927883|ref|YP_872434.1| thioredoxin domain-containing protein [Acidothermus cellulolyticus 11B]
    MTSDFSSARFAGAVALDALAQQRSAAPSSAAPTSGASSSGATVVDVTEATFQREVVERSMTVPVVIDFWAGWCGPCRQLS
    PILERLAAEGGGSWVLAKIDVDANPRLAAAAGVQGIPAVKAVWQGQIIGEFTGAIPEAQVRGWIRELLSVTGNSAGTVPP
    ADPLRSQADEALRAGNYDAAIAAFEKILAERPGDSDAKSGLERAKLLKRVAGADRNALHAAVAASPDDVGAQCALADLEV
    ADGEVAHGLRRLVDLVARTAGADRDAARRHLLELFDAVGPDHPEVAAARAALNRVLF

    >gi|117927898|ref|YP_872449.1| mercuric reductase [Acidothermus cellulolyticus 11B]
    MLVRISEYLEERAVHYDLAIIGSGSAAFAAAITAVGRGATVVMVERGQIGGTCVNVGCVPSKALLAAAAARHTASDSRFP
    GIATTAGPVDAGALRAGTDALVQQLRAEKYVDLAAEYGWTIVRGTARFAPGPVLTVATEDGPAQLEADHYLIATGASPWA
    PPIEGLAESGFLTSTTAMELTEIPDSLLVVGGNAVGLEMAQLFSRLGSTVTVVEALDRIAPFEEPEISAALRDVFADDGI
    TVHTSARIRRVRRGPEGYLLETDLPEGPRTLSGRELLIATGRRPNTADLGLAAVGVAAGSRGEVVVDAQQRTTNPRIWAA
    GDVTGGPQFVYVAAAQGNLAARNALDGSAESLDYSALPRVTFTEPSIASAGMTDAQAVAAGIRCDCRVLPLAMVPRALVN
    RDTRGLVKLVADADNGRLVGVHVLTDNAGDVIAGAVYALTAKMTVQQLADTWSPYLTMAESLRLAAQAYTRDVAKLSCCA
    A

    >gi|117928099|ref|YP_872650.1| carboxymuconolactone decarboxylase [Acidothermus cellulolyticus 11B]
    MAPKQRISYVPFDAMDEAMQAEILRCAREGTPRPESSAVRAHAPNAFWAFANSWKALFHEGICDHAIKDLCRIYISRTVK
    CEY
    CGNQRSTKAMAKGLSEAQYDELLNFESSDKYDDRQKAALAYAEAIAWGTDSDELWDRLHRHFSEVELVELGCFIALT
    FGQQSWIRLLNIEHHEYLPGTSAGMAPGFETRDALEKTKASSDYWAVKVAGGPRSSTA

    >gi|117928103|ref|YP_872654.1| carboxymuconolactone decarboxylase [Acidothermus cellulolyticus 11B]
    MKAPRISLVDPASAEGEVAEIFARQVAQFGTVSNFYRTLAHAPAAIACWTTMNAGLRLRYVTDDLSFLQVEQMAIIKTSQ
    LNGCDY
    CLGHNLELGRDAGLKPRQIAAVLGTVPDDDVLTPAQRCAVRWAEAVTLLTAEDDDELFTELRRHFSERQIVELT
    FLIGMWNCSNRVNRALRVELEAPECRLHFVRPAGSPTRTERGREG

    >gi|117928144|ref|YP_872695.1| dihydrolipoamide dehydrogenase [Acidothermus cellulolyticus 11B]
    MAEQSDVFDLVILGGGSGGYAAALRAAELGMRVALVEKDKVGGTCLHRGCIPTKALLHAAEIADQAREAATFGVRATFEG
    IDVDAVHQYKNGVVNRLWRGLQGLIKSRQITYVEGSGRLAAPTAVEVDGRRYEGRHVILATGSQPKSLPGLEIDGERVIT
    SDHALTLDRIPKSVVILGGGVIGVEFASIWRSFGAEVTIVEMLPHLLPTEDEDSSKLLERAFRRRGITFELGARFEAVKT
    TDTGVTVTLAGGKTLEAEYLLVAVGRGPVSAGLGYEEAGVRMDRGFVTVDEYCRTNVPTISAVGDLIPTLQLAHVGFAEG
    ILVAERLGNLAPVPIDYDGVPRITYSEPEVASVGLTEAAARQKYGEVKTFVYDLAGNGRSQILRTSGAVKVVAVPDGPVV
    GIHAVGSRVGELIAEAQLIYNWEALPSEVAQLIHPHPTQSEAIGEAHLALAGKPLHVHG

    >gi|117928162|ref|YP_872713.1| iron-sulfur cluster assembly accessory protein [Acidothermus cellulolyticus 11B]
    MCDDGMRSDDAAEGSGQMTVRSEATAQGVILTDKAAAKVRALLEQEGRTDLSLRVAVQPGGCSGLRYQLYFDDRSIEGDL
    VQEFGGVNVVVDRMSAPYLAGATIDFVDTIEKQGFTIDNPNATGSCACGDSFH

    >gi|117928586|ref|YP_873137.1| methionine-R-sulfoxide reductase [Acidothermus cellulolyticus 11B]
    MERIIRSEAEWRAQLSPAEYAVLREAATEPPFSGEYVNTTTPGVYVCRACGAELFRSETKFDSHCGWPSFYAPQDTDAVE
    LLPDHSHGMIRTEVRCRRCGSHLGHVFHGEGYPTPTDDRY
    CINSIALRLVPED

    >gi|117928624|ref|YP_873175.1| thiosulfate sulfurtransferase [Acidothermus cellulolyticus 11B]
    MPDLLVDVAELAEWLDGPRPPVLIDVRWNIAGPPGVLAYRAGHLPGAVFLDIDGDVCGRPGTGGRHPLPHPDDFQECARR
    AGISENSDVVVYDAADSTAAARMWWTLRYFGHERVRVLNGGYAAWVAAGYPVTTDVPQPPPGNFVARPGNMPVLDADGAA
    EIAASGVLADVRVPERFRGEVEPYDPVGGHIPGARNVPSGGNIRPDGRFRDPVELRDRFTAAGMADAAPVGVY
    CGSGIHA
    AHTAFAMTLAGLPTPPVYIGSWSNWVADRRRSVAVGDAESQRLVESCGN

    >gi|117928815|ref|YP_873366.1| OsmC family protein [Acidothermus cellulolyticus 11B]
    MATTRTATTHWEGPLLDGGKGTVSLDSSGLGSYEVNWPARAEQPNGMTSPEELIAAAHSACYSMALSNALAKAGHTDITL
    ETTADVTFQPGQGITGITIRVRGRVPGLSAEQFASFAEDAKVN
    CPVSKALAATPISLDATLA

    >gi|117928859|ref|YP_873410.1| heavy metal translocating P-type ATPase [Acidothermus cellulolyticus 11B]
    MAAETRHPTTNPTESEYADIELAISGMTCASCAARIEKKLNRLDGVRASVNFATEKAQVTFDPARVTPADLVATVEAAGY
    RARLPERVARAGAGSAQLHEPAAPGAGAAAAPAGTERSPVRSPAETPDDETTGVRTRLLISAALTVPVVLLAMVPSLQFR
    FWQWLSFTLAAPVVAWGAWPFHRATLINLRHRAVTMDTLISVGVLAAFGWSVWALFLGGAGEPGTHMRFELIPHAAGNHP
    DLYLEVASGVTTLILLGRYLEARAKRRSGAALRALLELGARDAAVIRDGAEVRIPVEQLAVGDRFVVRPGEKIATDGVVE
    EGTSAVDMSMLTGESVPVEVGPGSEVVGATVNVGGRLVVRATRVGADTALAQIARLVAQAQAGKAPVQRLADRISAVFVP
    VVIALAAATLLFWLADGASARFAFTAAVAVLVIACPCALGLATPTALLVGTGRGAQLGILIKGPDVLESTRRVDTVVLDK
    TGTVTTGEMTLLDVISAPGVSSEEALRLAGAVEDASEHPIARAIARAARERFGELPAVESFTATAGLGVVGVVEGHAVVV
    GRAAFLADWGLHPGAELTDAATKAETAGRTPIFAGWDGELRAVFVVADTPKPTSRAAVAELRRLGLRPVLLTGDNARTAE
    AIAAEVGIDEVVAEVLPAEKVAAIKELQARGRVVAMVGDGINDAAALAQADLGIAMGTGTDVAIEASDITVISGDLRAVV
    DAIRLSRRTLATIKGNLFWAFAYNVAALPLAAAGLLNPLIAGAAMAFSSVFVVTNSLRLRRFGVAHAPASGAASQ

    >gi|117928889|ref|YP_873440.1| redoxin domain-containing protein [Acidothermus cellulolyticus 11B]
    MPKLTVGDAAPDFTLPDADGKPVALRDFRGRQVIVYFYPAAMTPGCTTEACDFRDNLAALDSRNIAVVGISPDPVEKLAK
    FRDAYHLTFPLLSDVDKNTLIAYGAYGEKTNYGKTVMGVIRSTFIVGADGRIEHAFYNVKATGHVARLLDELGFTQQP

    >gi|117928979|ref|YP_873530.1| glutaredoxin-like protein [Acidothermus cellulolyticus 11B]
    MPDGTTVTIFTTPWCGYCRRLKRELDEQGIPYQEVNIEADPEAADLVARVNGGNQTVPTVLFPDGRTLTNPPASAVIARL
    ADLQATPQR

    >gi|117928984|ref|YP_873535.1| molybdopterin biosynthesis-like protein MoeZ [Acidothermus cellulolyticus 11B]
    MAYPPLVEPADTLTVDEVRRYSRHLIIPDVGMAGQKRLKNAKVLAIGAGGLGSPVLMYLAAAGVGTLGVIDFDTVDESNL
    QRQVIHGQSDIGRSKAQSARDTIKEINPFVTVVLHEERLDNDNVLDIFSQYDLIVDGTDNFATRYLVNDACVLLGKPYVW
    GSIYRFDGQVSVFWANAPGGQAPCYRCLYPEPPPPGMVPS
    CAEGGVLGVLCATVGSIQATEAIKVLTGIGEPLVGRLLVY
    DALEMTFRTVNVRKDPECPICGKNPTITELIDYEEFCGVASEEAQLAAAGSTISPLELKEWMDRGENIFLVDVREPAEFE
    IVSIPGATLIPKGEFVMGTALEKLPQNKRIVLY
    CKTGGRSAEALAIVKAAGFADAVHVGGGVVGWVKQVDPSLPSY

    >gi|117929036|ref|YP_873587.1| DSBA oxidoreductase [Acidothermus cellulolyticus 11B]
    MSRTTVDFYFDAVCPFAWITSRWILEVAQLRDIDVRFRVMSLALLNEGKEHSPEYAELMRSARGIARVCIAAAQHAGDDV
    LTDLYTALGHRLHNDKRTDYPNVIAEALSEVGLPAELAAAADTDRYDGALADSHRRGMAMVGDDVGTPTIHVDGVGIFGP
    VFSRIPRGEEAARLFDAVLTLMRHRTFYELKRSRTEPLVFD

    >gi|117929090|ref|YP_873641.1| hypothetical protein Acel_1883 [Acidothermus cellulolyticus 11B]
    MANRLATATSPYLLQHKDNPVEWWPWCEEAFAEARRRNVPILLSIGYSSCHWCHVMAHESFEDPATAAFMNEHFVCVKVD
    REERPDIDAVYMEATQAMTGRGGWPLTCFLTPDGEPFFTGTYFPKEPRAGMPAFRQVLEAVWTAWQSRSADLVAAARRVV
    AVLQQGSRLTDDLGAIDADLLDAAVGELRRQYDPVHGGFGSAPKFPSATTLEFLLRYGSLGAMEMVAVTCEHMARGGIYD
    QLAGGFHRYSVDAAWTVPHFEKMLYDNAQLLGVYLHWWRRTQHQLARRIVEEVAEFLLRDLCTPAGGFAAALDADAGGVE
    GGTYVWTLAELRDALGSDDAAYAAELFGVTEHGNTEDGRSVLQLAVDAPDLERWRRIRQRLLAVRSRRAQPARDDKIIAS
    WNGLAVASLAEAGFLLDRDALVDAAVRSAEYLIDVHLRDGRLCRSSRDGERNPVDGALDDYANVAQGLLTLAQIRSEARY
    LELAGALLEAILTHFRAEDGGFYDTADDAERLVRRPRTFTDDATPSGNSAAAHALLTYAALTGSQRHRDAVPGALRPTVR
    LARRYPHAVGYGLATIAAWLDGPAEIAVVGDGSLWRTAWLVDRPGAVRAARAADGPPWAPLLEGRTAPPGQSLAYVCRNF
    ECQRPVASEAELRALLES

    >gi|117929091|ref|YP_873642.1| methylated-DNA--protein-cysteine methyltransferase [Acidothermus cellulolyticus 11B]
    MKFFTTTATPLGDMLLVGDGSSDGLALCGAYFIGQRHSVPVDPSWRNEPDAFSEAVVQLTEYFGGERCVFTVPLRWHGTP
    FQETVWRELLGIPYGATWSYRDLAEKVGHGGKARAVAAAVGRNRLAVFVP
    CHRVIGADGSLAGYAAGVDRKRWLLEHEGA
    LPRGTDTF

    >gi|117929105|ref|YP_873656.1| peptide methionine sulfoxide reductase [Acidothermus cellulolyticus 11B]
    MGILRPLPTLDQALPGRNERAFTLSGRHAVLGTPIEPPFPEHTQRAVFALGCFWGAERIFWRLPGVYTTAAGYCGGFTPH
    PTYEEVCTGLTGHAESVLVVVDPAIVSYAELVKVFFEAHDPTQGMRQGNDIGTQYRSVIFVADAGQRAAAERIREQYAST
    LGRAGFGPVTTEIANAGPFYYAEEYHQQYLHKNPSGYCGLQGTGVSCPLSSA

    >gi|117929199|ref|YP_873750.1| twin-arginine translocation pathway signal [Acidothermus cellulolyticus 11B]
    MSRRRVWTGAAVVALLVAVAFAINRVTATGSSVPKPSVALVQQADLDRCPSATGSAAPNGLPDLTLPCLGTGPAVNLARL
    RGPLVVNIWSSH
    CTPCRAEGPLLQRFFAAHGSRVGVLGVVDGAFPDTPNDALSLAAGLGLHYPSVFDATGTLVNRLALTG
    IPVTLYVAADGSIAGRHIGELHRGDLERDVARYLGLPLS

    >gi|117929355|ref|YP_873906.1| thioredoxin reductase [Acidothermus cellulolyticus 11B]
    MASESDTIRSLIIIGSGPAGYTAALYAARAKLQPLVFEGSVGAGGALMTTTEVENFPGFPDGIQGPDLMERMRAQAAKFG
    AELVPHDVVAVDLREPVKVVRTDEGEYRSRALIIATGSKYRYLGLANEQRLLGRGVSA
    CATCDGFFFRDQDIAVVGGGDS
    AAEEALFLTRFARSVTLIHRRDALRASKIMQDRVFANDKIRIRWNARVIDVLGDDRVEGVLLEDTRTGDQETLPVTGLFI
    AIGHEPRSELFRGQLEIDAAGYIQVAHPTTRTSVPGVFACGDVVDYIYRQAVTAAGTGCAAAIDAERWLAEQDAGLSTSV
    LTTTGSA

    >gi|117929356|ref|YP_873907.1| thioredoxin [Acidothermus cellulolyticus 11B]
    MTVTTAVTDETFESEVLASDKPVLVDFWAEWCGPCRMVAPVLEEIAAEYGDKLRIVKLNVDENPKTTQAYSILSIPTLNV
    FQNGQVVKQIVGAKSKAALLKDLEPFLS