Acaryochloris marina MBIC11017 uid58167

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|158333343|ref|YP_001514515.1| glutaredoxin-related protein, putative [Acaryochloris marina MBIC11017]
    MSGHEVNITLYRWAGAWGPFKVKIPCGECTLTKDVILDTLENELAGIPVILEIREWLTEWWKPLLKGGWHAPIVMVNGKV
    ISQGHALNRGLLTEAVTAAYASKAPIQRSHLFGKES
    CPHCKRAKAYLDQVGIQYTYHDVVRSPRALYEMLARVKPLVGPK
    TPITVPQIWLGGQYIGGADRLEQVMQEQGLFRPEFNTVKTTLQPR

    >gi|158333369|ref|YP_001514541.1| mercuric reductase [Acaryochloris marina MBIC11017]
    MTQSSFSGVNIPPMDVHNRKLVNNVHPPDWVNPTPVECYDLVVIGSGTAGLVTAKGAAGLGVGLKVALIEKHLMGGDCLN
    VGCVPSKCLIRSARVVADMRDAQPYGIQPPAQIDVDFQVVMERMREVRARISPVDSAAAAAKSGVDMYLGEGKFTGPNTV
    SVDGRTLRFKKAVITTGARAVRPRIEGIEEVGYLTNETVFSLTELPQRLAVIGGGPIGCELAQSFHRLGSQVVLFHRGAH
    LMSKEDADAAEIVQQAFLKEGIKLVLACQMKRVERTPSGKVIHFVCDGREESVVVDEILAGAGRAPNVDGLNLEAVGVEY
    DSRKGVAVNDYLQTTNPKIYAAGDICMNWKFTHAADAAARIVLKNTLFSPFGIGKYKLSDLVMPWVTFTDPEIAHVGLYE
    GEAQDRGMDVNTIKILFDDVDRALADGEEEGFVKIHLAKGSDKIIGATIVARHAGEMISEITTAMVGKVGLGSMASVIHP
    YPTQAAAIKQAADAYRRTLLTPKTIKFLGLLTKLS

    >gi|158333647|ref|YP_001514819.1| rhodanese domain-containing protein [Acaryochloris marina MBIC11017]
    MTQVSPLAYTKLIPPPLLLDVRSVGEYRAEHIPNAINLSLLRLLIGQLPIINRWVLPDWFQALSKDQPIVVVCLTSHRSP
    LAAAQLLKAGFTQVFNLSGGMQHWRQCGFNTISGYPSGFTVTTPGHLGPKPNT

    >gi|158333658|ref|YP_001514830.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Acaryochloris marina MBIC11017]
    MKLNRTNLEQRLDHLYDVIVVGGGAGGLSAGIYLQRFRLSSLIIDKGKARSSWMQSLHNYLGLPPDTSGRKLLQQGKKHY
    DSLAGDFLDGYVEEVTDAENIFEIQVKVGRQNSRNVKFYSKYLIVASGIIDHLLPLEDMQNVYDYAGYNLHV
    CMVCDGYE
    MTDKLCGFFAGSEASIEEMVFNLSWFTPKITIFTHGLFEVSGQMRSQLQEYGYRLVETPIQKFLGENHQMTGVELVNGSV
    IELETGLISMGARYHNTYLQELSLEMKGGNLVTDKLGRTSHPRIFAIGDLKVGLNQVVVAAGDGALAATQIWREIRKDIG
    PRKWLMNLKLPT

    >gi|158333708|ref|YP_001514880.1| hypothetical protein AM1_0514 [Acaryochloris marina MBIC11017]
    MLNPNLDQIQLNKEEYERFSRHLILPEVGLEGQKRLKAASILCVGTGGLGSPLLLYLAAAGVGRLGIVDADVVDSSNLQR
    QVIHGTSWVGKPKIESAKNRIHEINPLCQVDLYNTWLTSENALEIAEPYDIVIDGTDNFPTRYLVNDACVLLDKPNVYGS
    IYRFEGQATVFNYEGGPNYRDLYPEPPPPGLVPS
    CAEGGVLGILPGIIGIIQATEAIKIILGQGTTLSGRLLLFNSLDMK
    FRELKLRPNPERPVIEKLVDYQEFCGIPQAQAAEAEQKANMEEMTVQDLKQLLDSGADDFVLLDVRNPHEYEIARIPGSV
    LIPLSEIESGEAIPKVKELLNGHRLIAH
    CKMGGRSAKALGFLQEAGISGTNVTGGITAWSREIDSSVPEY

    >gi|158333887|ref|YP_001515059.1| methyltransferase, putative [Acaryochloris marina MBIC11017]
    MTSNYIHGYSAAEQQRLLQQSQYWQDRLICPGLDYQPGDRVLEIGCAVGTTLGILATQFPGIEVAGLDRESNQIQQARQY
    LSSINVPVDLQVGEAENLPWPNDHFNHVYIMWLLEHVVEPLPILLEAQRVLETGGTITLIETDYTSHVVYPQSEDYDYLA
    HAQ
    CQLFSQTGNPLVGRQLGSLLVQAGFAGVQNQPVGFHVFQGMPDQALRQHVEYCLGFLEPMIPQMVQLDLDEQRLLEG
    LAHLQAIPDHPEGAMTTIVYRAQARKK

    >gi|158333951|ref|YP_001515123.1| hypothetical protein AM1_0765 [Acaryochloris marina MBIC11017]
    MSTPLSWSELADRTDFHLDPVNGPTNAQSCLRLFGQSEDDVKVTLFRDNHAWCPYCQKIWLWLEEKQIPYRIEKVTMFCY
    GEKERWYKQIVPSGMLPALELKGQVITESDDILIALEKEFGPLGKGMQDPAVMPLRQLERLLFRAWCTWLCYPSRPRQDQ
    RNREQFVSVVKKVEAALSQTPGPYFLEEFGTADAIFTPYVERMNASLYYYKGYSLREENPRFSDWFDAMESRPTYRGTQS
    DFHTHAHDLPPQMGGCYKNNDPQTPINMSRVDNGPWSELPDVTYPEPETSRAEALHRVVKHHENIIKVNPTKDELIDEAL
    RCALTHLITGEVCTPPSGSDLGLRYLRDRISVPRDMSIYAAKRLKESLEATAALVGNRQGTPIPVRHRRDQDPTNFAKA

    >gi|158334008|ref|YP_001515180.1| glutaredoxin 3 [Acaryochloris marina MBIC11017]
    MPNFLNNLLGRHPERVKANTEIYTWQTCPFCIRAKLLLSWKGVKYTEYKIDGDEAARAKMAERANNRRSVPQIFINNQHI
    GGCDDLYQMDTMGQLDDLLSQPAAS

    >gi|158334045|ref|YP_001515217.1| glutathione S-transferase family protein, putative [Acaryochloris marina MBIC11017]
    MSKFKVYGDIYSGNCYKVKLLLSLLEIEHDWIHIDILKGESRTNDFLERNPNGRVPVLGLPDGRWLFESNAILHYLAKDS
    SFLPAEPFAQAQVLQWQFFEQYSHEPYIATSRYIIRYLGSPPDRQADLEARRVWGYAALDVMESHLEKQDFFVNTQYSIA
    DISLYAYTHVASEGGFSLKPYTNVRKWLRRVSQHPKHVTMDQFAP

    >gi|158334068|ref|YP_001515240.1| hypothetical protein AM1_0884 [Acaryochloris marina MBIC11017]
    MPKTPSQTSTAWHSPQWYQRFFAWAMATAAQGYETKMADRKRQLFSHLQGEVLELGPGAGPNLPYFKPEIHWLGLEPNPY
    MHPYLQQQADSLGLNIDVQTTTLADIAIPDNSKDVVLCTLVLCSVPDLESTVQDILRVLKPGGQFLFIEHVMAPAGSFLR
    RVQTGL
    CPLWQVIGDGCRLDRETGKVIESAGFAKVDYQTFEAPVPIAVVKPHIIGAATKAS

    >gi|158334138|ref|YP_001515310.1| copper-translocating P-type ATPase [Acaryochloris marina MBIC11017]
    MTQTVTLKLDGMSCAACANSIEKVLKNLAGVEDCSVNFGAEQATVHYNPEQIQPKAVAASIDAAGFGAEILDDQDWYKLS
    DNLTQSPSSTTSQQLRLKVLIGGIISVLLMVGSLPMMTGIPMAWIPAWAHHPILQFILTVPVQFWCGYSFYGGALKALKQ
    RTATMDTLIALGTSAAFFYSLVVTFIPAGTDQDLGVYYETSAVVITLILLGRWFEDRAKGQTSTAIRQLMGLQAKTARVI
    QDGQVVEIEIASVQPGDTVLVRPGEKIPVDGEIIEGQSTVDEAMVTGESQPVQKQPGDLVIGATLNKTGSFQFRATHVGK
    ETVLAQIVKLVQEAQGSKAPIQRLADQVTGWFVPAVITIAVLTFIVWLLTTQTLSLALITAVGVLIIACPCALGLATPTS
    VMVGTGKGAEHGILIKGAESLELAHKIQTIVLDKTGTLTEGKPTVTDFMAVKGTSHGNELHLLQLASIIESHSEHPLAEA
    VVRYAQAQGVDVSLSDTQNFAAIAGQGVQAQVQGRQVYIGTQRWFQTLKIKTDALQTYAHQWEIQSKTVIWLAVDHQLEA
    IMGIADALKPTSIEVVQTLKQMGLEVVMLTGDNQRTAGAIAAQAHIEQVKAEVRPDQKAAAIQQLQANGHIVAMVGDGIN
    DAPALAQADVGMAIGTGTDVAIAASDITLISGDLQSIVTAIQLSRATMGNIRQNLFFAFIYNIIGIPVAAGILYPFWGLL
    LNPMIAGAAMAFSSVSVVTNALRLRRFQPGSFRQ

    >gi|158334255|ref|YP_001515427.1| glutathione-S-transferase domain-containing protein [Acaryochloris marina MBIC11017]
    MATYPILYSFRRCPYAMRARLALTVSQQICELREVVLRDKPQEMLDISPKGTVPVLVQVDGSILEESLEIMMWALKQQDS
    EVWLRADSGQMAHLHALVAACDGHFKHHLDRYKYAQRYENTNAQEHRAEGSKFLETLNHQLGETTYLCDQHRSWADMAIA
    PFVRQFANTDRPWFDAQPWPHLQTWLGEFLESDLFQQIMGKYPQWKSGEVGPLFPGP

    >gi|158334256|ref|YP_001515428.1| rhodanese domain-containing protein [Acaryochloris marina MBIC11017]
    MSEFLTVAFYKFVELQDYAELKAPLLACCQDNDVQGTILLATEGINGAIAGLPHNIHTVLDFLCGDPRFADLAPKESWSE
    KRPFYRMKVRLKKEIIKMGVPDIDPTQTVGEYVKPEDWNQLLADPDVVVIDVRNDYEVAIGTFKGAINPNTKSFSELPEW
    LQEQAELQKKPKVAMF
    CTGGIRCEKSTALLRHEGFEDVFHLQGGILSYLEKVPEDESLWQGDCFVFDERVAVGHGLKPGR
    YQLCRACRTPISPEDMKSEHYVPGQSCPHCYGTKTEEQQQRFAERQRQIELAKQRNQVHIGAKYSRHQPG

    >gi|158334323|ref|YP_001515495.1| rhodanese family protein [Acaryochloris marina MBIC11017]
    MYSQDFSSIPEIDVETLAAQLNDDVTRIQLLDVREPQEVAIASLNSFQNIPLSEFAEWSTTIGEQLDQHQETWVMCHHGM
    RSAQVCVWLSQNGFTNVKNVSGGIDAYSMKVDTSIPRY

    >gi|158334340|ref|YP_001515512.1| bacterioferritin comigratory protein [Acaryochloris marina MBIC11017]
    MTLDIGDYAPEFTLPNADGESIDLKRFRGQWVVLYFYPRDNTPGCTKEACGFRDQYETYQTEQVVILGVSGDDAKSHQKF
    INKQNLPFQLLSDLDFNVAKSYEAYGPKKFMGKEYEGIYRHSFLIDPDGKLAKIYRKVKAADHATDVLQDLELLRK

    >gi|158334352|ref|YP_001515524.1| hypothetical protein AM1_1172 [Acaryochloris marina MBIC11017]
    MPNRLAHSASLYLRKHADNPIDWWPWCEEALERAAQENKPIFLSVGYSSCHWCTVMEGEAFSNSEIAKYMNAQYIPIKVD
    REERPDIDSIYMQAVQAMTGQGGWPLNMFLSPGDLVPFYGGTYFPEEPRYGRPGFLQVLEAIRSFYDTEKEKLDTQKEKL
    SGHLQSSTVLNPIGDLQPELLSKGIAKNTTVLINKMPGPSFPMMPYAAIALHGSRFSTPDQEKAQQACRQRGLDLALGGI
    YDHVAGGFHRYTVDPTWTVPHFEKMLYDNGQIVEYLANLWSAGVKEPAFERAIAGTVAWLQREMTAEAGYFYAAQDADNF
    VTTADIEPEEGRFYTWTDSELTHLLTTEEYAAMAEIFNLSAQGNFEDGLTVLQRQQPGVISETVEEALRKLFQVRYGERP
    ESLTTFPPATNNQVAKTHPWPGRIPPVTDTKMIVAWNSLMISGLARAAAVFQQPDYLALATKAARFILDQQWSEGRLHRV
    NYDGEIAVIAQSEDYALLIKAFLDLHQASQSLAVDQASRWLEAAQTTQAEFDEHLWAVEGGGYFNTGSEMSEELLIRERS
    WLDNATPAANGVAIANLIRLSLVCDRTEYLSQAEQALQTFGQVMGSSTQACPSLFVALDWYFHHTSIRTSADLASTYLPT
    AVYSPSSEVPTGAIGLVCQGFRCLEPAMTMAELHQQISDSLTRHQV

    >gi|158334590|ref|YP_001515762.1| selenide, water dikinase, putative [Acaryochloris marina MBIC11017]
    MENQRPIEKELVLIGGGHSHAIALRNFAMNPLPGVRITLISEQSNTPYSGMLPGHVAGHYTYEECHIDLRRLATAAQAQL
    YVDRAIGLDLDRNQVNCAGHPPVRFDILSIDIGSTPELPDVPGILDYSVPVKPWRFFLHQWQQVIDRVSQHPNQPISIGV
    VGGGAGGVELVLTIQHQLQQILQAAGQPLANLTMHLFHRGARVMTGHNARIRNRFQQILIQQGIHLHLKKTVLQVQKGKV
    FCESGFQVECDTIFWVTRASAPIWPQQSGIATDERGFIQVQPTLQSVSHPHIFAAGDIAAMVASPRPKAGVFAVRQGKPL
    AENLRRLLQGNKLQIYKPQSKFLSLISTGDRKAIMSWGALPLGNESAWLWRWKDAIDRKFMDQFREFLEMGPDVELPAEN
    SIPMQCTG
    CGSKVGSPILEKTLSRLHQDYPPLRQDILVGLGGADDAAVVEVPPGQVMVHTLDYFRSLINDPFIFGQIAAH
    HSLSDLFAMGAEPQSALAMATLPYGSDQSLQETLYHLLAGATKVLQQAGAELVGGHTTEGAELAFGLACNGLIDRKGILS
    KHGIQPEQVLILTKPLGTGLIFAAAMRQQTRNLWIDSALQSMLQSNQAATQCFLEYQATACTDITGFGLIGHLSEMLRSS
    PIHVQLNLNSIPAMPGVAEIISQNIHSSLYPQNLKAGHWVANQDQFQTHPLWPLLFDPQTSGGLLATVPMEHASECLEDL
    EKVGYRQSSIIGKTVPMQPQTSSSRQQPIIIH

    >gi|158334993|ref|YP_001516165.1| copper-translocating P-type ATPase [Acaryochloris marina MBIC11017]
    MTSLSPPPSTQQVVLAVSGMKCAGCVQAVEKRLQQQPGVATAVVNLVMEQAAIEYVPQEIEPASLAQVLTIAGFPSHIQN
    REEEAEPLPPQPLKEIQPLVLATVLVVLSGVGHLGHIPGFTLPWLTSIQFHWGLATLALLGPGRPILQEGWQGLWQNRPN
    MNTLISLGSITAYLASVVAVVWPQLYWDCFFDAPVMIVGLILLGRALEAQARGRTKASLEKLLALQPMVARWLPNPETQP
    DRTVDIPVRDVQIGAWLQVLPGDKFPVDGRVLEGSTLVDEAMLTGEAMPVPKASGDEVVAGTLNQSALITIEATRTGQQT
    TLAQIIDLVETAQTRKAPIQQFADRVAGYFTYGVLAIATLTFLFWVGIGVHLWPDVLASGTLPMMHSPDVGMAEMAPRSA
    GILLGLKLAIAVLVIACPCALGLATPTAILVGTSLGAERGLLIRGGDVLEQVDRLDTLIFDKTGTLTTGHPQVTDYWVSE
    GLPALPVGDHLSSQTVLQLAASLEKGSRHPLATAIVEQADAQDLAYASATALETVPGCGIKGQLEGTFIRLGSAQWLQDC
    GIVIPPQDQHQGHHLAQAGKTLIHLATDQTYVGGVAVQDTLRSDAAQTLKDLKGLGLRIQMLTGDQAETAHIVAQELGLD
    PTAVRAGVTPGDKAAVIADLQAQGHQVGMVGDGINDAPALAQADVGISLSGGTDVAIETAQIILMSGDANPLYRLVDVLR
    LSRATFRKIQQNLFWALIYNLIGLPIAAGILLPKFGILLSPASSAALMAFSSVSVVTNSLQLRRLSLQAKYSSH

    >gi|158335030|ref|YP_001516202.1| thioredoxin [Acaryochloris marina MBIC11017]
    MSSAAPVTDATFKEEVIESDVPVLVDFWAPWCGPCRMVAPVVDEISEQYKGQVKVVKINTDENPNVASQYGIRSIPTLMV
    FKGGQRVDMVVGAVPKTTLASTLDKYL

    >gi|158335043|ref|YP_001516215.1| thiosulfate sulfurtransferase [Acaryochloris marina MBIC11017]
    MVSSQWLHEHHEDAQVVIVDCRFALSAPQQGREQYQAGHIPGAYYLDLNKDLSSPVQTHGGRHPLPNLSQFAAKLSQMGI
    TSETWVVAYDDSRQAFASRLWWLLRYLGHEKVAVLDGGLAAYQAHYPITTDIPEVRSGEFQASPNPGQVVDIQTVKAQKN
    QPNVTVVDSRAHERYLGNHEPIDPVAGHIPGAVNYPWQAVTNEDGFLRPSVELQAHYADLENVDEVIVY
    CGSGVTACVNL
    LALDIAGIKNGKLYAGSWSDWCSYPLDENMEAQV

    >gi|158335272|ref|YP_001516444.1| methionine-R-sulfoxide reductase, putative [Acaryochloris marina MBIC11017]
    MEKVQKTEQEWEAQLTPEQFRVTRHHGTERAFTGEYHDLKAAGTYQCVCCGTELFTSDTKFDSGTGWPSFWAPADKTHVE
    EKTDRSLFMVRTEVLCAVCDAHLGHVFNDGPKPTGLRY
    CMNSAALKFVPKS

    >gi|158335403|ref|YP_001516575.1| OsmC family protein [Acaryochloris marina MBIC11017]
    MISVQVASNHSRYGQDISIRHLNLAADEPPSLGGDDVGPTPTELVLAGLGSCKAITLQMYAERKGWKLESVAVELSYDSA
    VQQPTIQAKLSLRGDLDEKQRQRLRDISDR
    CPVHKLLTTPVAIQTQLT

    >gi|158335405|ref|YP_001516577.1| glutaredoxin 3 [Acaryochloris marina MBIC11017]
    MANVEIYTWSTCPFCRRAKHLLDQKGVTYTEYVLDGDETARDAMVARGTQGRRSVPQIFINDQHIGGSDALYDLEQQGKL
    DGLLNSSLAGATPLKPYQRGRNISGT

    >gi|158335645|ref|YP_001516817.1| thioredoxin [Acaryochloris marina MBIC11017]
    MLSTTSTQTFNPDVLQSETPVLVSFWAPWCGVCRWVEPMLIQVQADYGSALKIVTINADENFLIASQYRLTNIPSLLLFQ
    QGRLVHRIDQFCDRTEALNLLEKALGKIVPSLMSAG

    >gi|158335681|ref|YP_001516853.1| AhpC/TSA family protein [Acaryochloris marina MBIC11017]
    MTQSSGFFNQRYVNNFVPLPGKGEPAVGRLAPDFELPRIGGDSVKLSDYRGQQPIFLAFTRIFTEKLFCPFCYPHIQDLK
    QRYSEIVDRGAELLMISSTDQVQSEQIVSDLDLPYPFLYNPKCESFRNYGAGQALGAPLPAQYIVDVDGTIRFRHMFSFV
    DHNAGMDEVLTILEGLIPQG

    >gi|158335711|ref|YP_001516883.1| thioredoxin [Acaryochloris marina MBIC11017]
    MATKKQYKNFAELLAGSDKPVLVDFYAIWCGPCRMLVPILEQVSTLLKDKVQVVKIDTERYPELATEYHIHALPTLVLFK
    DGQPVERIEGVLPPEDIVSRVQPLL

    >gi|158335810|ref|YP_001516984.1| thiosulfate sulfurtransferase, putative [Acaryochloris marina MBIC11017]
    MVSALEAKVLIEQGATLLDARGNQWFGLNRLSGSVSIRWQDFSPSNKVRKGTLLESDAVLNQKLRKLGISQERPVVVFAN
    PPQGWGEEGRIVWMLRTLGHSQAVMVDGGYSALASLNLKAPEISQLGDFEIHRMPTWQIQKAALKAALDQPDLVLIDTRT
    PKEYAGATPYGEKRRGHVPGAISLHFQELLTPQGKLLPRDQIVAKLAELGITQASEVVAY
    CTGGIRSGWLTVVLADLGYQ
    VQNYAGSMWEWSAGSPQEFPLTVQSQGLKATDMPQ

    >gi|158335840|ref|YP_001517014.1| 2-cys peroxiredoxin, putative [Acaryochloris marina MBIC11017]
    MSQHEAHECLRVGQAAPDFTATAVYDQEFSEVKLSNYRGKYVVIFFYPLDFTFVCPTEITAFSDRYDAFKDLNTEVLGIS
    VDSEFSHLAWTQTDRKSGGVGDLNYPLVSDIKKEISTAYNVLDPDAGVALRGLFIIDKEGVVQHATINNLAFGRNVDETL
    RTLQAIQHVQSHPDEVCPAGWQPGDKTMNPDPVKSKVYFESV

    >gi|158335944|ref|YP_001517118.1| methionine-S-sulfoxide reductase, putative [Acaryochloris marina MBIC11017]
    MALFGLFGKKLTLPTAEEALAGRTTPMPVPEKHFVNGHALKPPFPEGMEQAMFGLGCFWGAERRFWQQEGVYVTAVGYAS
    GITPNPTYQEVCSGMTGHNEVVMVIFDPSKISYESLLQVFWESHNPTQGMQQGNDVGTQYRSGVYTYSDQQKALALSSKK
    IYQDALQKAGLSEITTEVLDAPEFYYAEDYHQQYLAKNPGGYCGLGGTSVTCPPLVEA

    >gi|158336063|ref|YP_001517237.1| thiol:disulfide interchange protein TxlA [Acaryochloris marina MBIC11017]
    MTLDPSDMPSDPEVNAATSSQRLRNFLVAMVAIALSIALFLGSRQQTEQPSLSTLAVNSTPLEVALANQKPTLMEFYANW
    CTSCQAMADDMNSLKQEFSDQVNFVMLNVDNSKWLPEVLKFDVDGIPHFVFLDGDGEALASSVGQQPRQILADNLAALVA
    EETVPKSQAIGQTSIFQPAVRGNQDDPRSHGGMPAGGLERS

    >gi|158336079|ref|YP_001517253.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant, putative [Acaryochloris marina MBIC11017]
    MKPLRHHLTRICLVLGLIVSLVMAAPAAFAMGGDPPPLDQPAPTFTLPSNTGDGEVSLSDYRGQWVVLYFYPQDFTPGCT
    VEAQRFQQDLPKYIERNTQVIGVSVDSVDSHAEFCDSEGLKFPLLADEDGSVSKAYGSWMSYFSLRHTYLIDPEGILREQ
    YVKVRPVIHSEEVLARLDELQAAS

    >gi|158336311|ref|YP_001517485.1| iron-sulfur cluster assembly accessory protein [Acaryochloris marina MBIC11017]
    MAEATQSQQRGIMMTDNALKHVLELREKQGTDLCLRVGVRGGGCSGMSYTMDFEDPKNIQESDEVFDYDSFKVVSDPKSM
    LYIYGLVLDYSDALIGGGFQFTNPNATQTCGCGTSFSA

    >gi|158336378|ref|YP_001517552.1| YeeE/YedE family protein, putative [Acaryochloris marina MBIC11017]
    MIGFNELTALFGGILIGTSATVLLLFNGRIAGISGIVNGAISFKSAESWRWIFIVGMLMGSALYEYVLAAQPTPISTFAP
    WAMLGGGFLVGFGTRMGNG
    CTSGHGVCGLGRLSLRSLVAVLTFMASAIATVFLTHHVLPGGL

    >gi|158336381|ref|YP_001517555.1| DSBA thioredoxin domain-containing protein [Acaryochloris marina MBIC11017]
    MQSLRFIAMGLLSLWLWLGWGTPALAVDNLEEQVLQIIRNHPEAIIESVQTYQQNQKQAQQQAQQAAIEKLKPNALVGSS
    PTTGAQNSPNLLVEFSDFQ
    CPFCAQAASDVQAFLQQNPNQFTFTYKHLPLQSIHDQALSAAKAAWAAQQQGQFWSYHDAL
    FTRQDELGDKLYTDIAQQLKLDLAQFDRDRNSDAALKAINSDLDLAQSIGITGTPFFALNGQVLPLPFNGSTVNALLKN

    >gi|158336474|ref|YP_001517648.1| ABC transporter, periplasmic solute-binding protein [Acaryochloris marina MBIC11017]
    MSRSDLRIVSLIPSGTEIVAALGCGSHLVGRSHECDYPEQVRTLPVCTAANLNAEQPSRDIHNQVMELLQSALGIYRLDL
    EQLQQLKPTHIVTQAQCEV
    CAVSLAEVEQALTQITDQTTQVISLQPSLLAHVWQDMERVAIALGCDSQSILQQLQARIKA
    CQQRQNIEHRPTVACIEWTDPLMIAGNWVPELVNLAGGDPCLGTIGQHSSWLTWEQLLAANPDMIVCMPCGFNLEQTAQA
    TQELAQQPQWQQLQAVQNQQVYLTDGNQYFNRPGPRLVDSMELLAEIFHPHIFPPRYAGHGWLKFH

    >gi|158336488|ref|YP_001517662.1| pyridine nucleotide-disulphide oxidoreductase [Acaryochloris marina MBIC11017]
    MDTYEFDVVIIGGGPAGCTCALYTSRANFKTVILDKNPAVGALAITHKIANYPGVAGDISGEELLTVMREQAMEFGTHYQ
    QAQVFGLDITGAQKKVYTPEGTFVGRAIVLATGAMGRKASFDGEAEFLGRGVSY
    CATCDAAFYKDRPVAVVGLNREAIEE
    AQVLTKFSSMVHWVTVKTPPAEDTHAQDLLSLPNVKHWSRSRLLSIQGSDMGVSGVQVKVRDQDEPIGLEVDGVFVYQNG
    SKPITDFVGDQVHFNPDGGVKVDELMATSVDGVWAIGDIRNTPFKQAVVAAGDGCVAAMAIDRFLNSRKLFKPDWDHS

    >gi|158336597|ref|YP_001517771.1| membrane associated glutaredoxin, putative [Acaryochloris marina MBIC11017]
    MTTLNTTQTPVKLYRMSTPDHDCPWGLKAIHLLKEQGIEYEDHPLRSKEEVEAFKAKHDVPTTPQIFMGEECIGGYTDLA
    QHFGVEVEAADYSYTPVVALFSTAGLITLATSLGMTGFMGVSLSMLASLKLMDLDAFAEGFQRYDLITKTFKPYAKSYPF
    AELLIGLGFLSGVAPLLTGISSLLIGTSGAISVFKAVYIDKLALNCACVGGNTKTPLGIVSFAENAIMAGMGAFLIFTSV
    GDRTLEAVQTPDSLSSAVVQLRDDV

    >gi|158336812|ref|YP_001517986.1| peroxiredoxin, putative [Acaryochloris marina MBIC11017]
    MAVFATERVPDVVFKTRVRDESVPGPNPYRWQDKTTQDIFGGKRVVLFSLPGAFTPTCSSTHLPRYEELHEEIKAQGVDE
    IICLSVNDAFVMFQWGKHQGADKVFLLPDGNGEFTRKMGMLVDKSNLGFGMRSWRYSMVVNNGQIEKMFIEADYGDNCPT
    DPFEVSDADTMLAYLKGVHATAAPTAAAVG

    >gi|158336813|ref|YP_001517987.1| glutathione reductase [Acaryochloris marina MBIC11017]
    MSYDYDVFVIGAGSGGIATARRAAEYGAKVGIAEYGRLGGTCVNRGCVPKKLMVYASHFPSHFDAATGYGWSPVESQLDW
    LKMITAVNDEVTRLNGIYQRMLDNSKVEVYRGRAALVDAHTVAIGDQKVTADKILVAVGGKPVKPANIPGIEHAITSDDI
    FNLKEQPKHLVVLGGGYIGIEFACILKGLGSEVTLIIRADKILRGFDDDIRTEIQDAMQKHGIRVLNNMTDLAIAKSDTG
    LQITVKQADNAEETILADAVSLAATGRIPNLEGLGLENTAVEVDGGAISVNEYSQTAEPNIYSVGDCTDRINLTPVAINE
    GRAFADTHFGGKSRTMSYDNVPTAIFTTPEAATVGLTEAEAQEQYGEDKIKVFRSRFRPMYYTLPNHDVKTLMKLVVNTD
    TDQVLGAHMVGDHAGEIIQGVAIAVKIGATKAQFDATVGIHPSSAEEFVTMR

    >gi|158336943|ref|YP_001518118.1| redoxin domain-containing protein [Acaryochloris marina MBIC11017]
    MSFFQPQRRKLLSLLGLGAASAVGAALLPRSQNRSVTAFETPSNTSLWTKRDDVNLGQPLHPFQGISHWLNSEPLSIADL
    KGKVVLVQFWTFG
    CINSQRTLPYVTRWHQQYADQGLQVIGIHTPEFKYEHAASNVQKALAEYQIAYPVPLDNNYQTWKAY
    RNRYWPHLFLTNREGVITYHHIGEGAYQETEQTIQALLG

    >gi|158337295|ref|YP_001518470.1| redoxin domain-containing protein [Acaryochloris marina MBIC11017]
    MSLATELQAVTENVRQQAPENVFTTMEAATAKLAATGITDQALQTGQTMPDFELPDATGKSVSSSELRAKGLLLISFYRG
    NW
    CPYCNLELQALQARLDDIAALGATLVAISPESPDQSLTTQEKFDLKFPVLTDTGNQVARQFGLVFTLDESLRPIYNNF
    GIDITTHNGDQSFELPVPATYLVAADGTVLNHFVDVDYRERLAPETALAWLQAAQ

    >gi|158337422|ref|YP_001518597.1| methyltransferase [Acaryochloris marina MBIC11017]
    MTQSMQFWDKVADSYAKQPIADQATYEKKLEVTQKYLQPDMEVLEFGCGTGSTALIHAPHVKHIRAIDFSANMIKIARSK
    AEAQNIQNVTFEQASIDELSLPNQSIDVVLGLNVLHLLKDKETEIAKVYNILKPGGRFITSTV
    CLGGTMDWLKVVAPIGK
    FLRLFPLVRVFSVQELEQSLTDAGFEVEQPWQPSEFTWQLGSGKVAFIVATKAA

    >gi|158337482|ref|YP_001518657.1| dihydrolipoamide dehydrogenase [Acaryochloris marina MBIC11017]
    MTQQFDYDLVIIGAGVGGHGAALHAVDCGLKTAIIEAADMGGTCVNRGCIPSKALLAASGRVRELRDQHHLQSLGIQLGQ
    VNFDRGQIAAHADNLVDTIRGNLTNSLTRLKVEIIHGWGKVIGNQKVVVKSDAGEQTITSRDIIIASGSVPWVPPGIEID
    GRTVFTSDDAIRLSWLPDWVAIIGSGYIGLEFSDVYTALGSEVTIIEALDTLMPTFDPDIAKIAKRVLIDPRDIDTHAGR
    LAKKVTPGSPVVIELADVKTKEVVEVLEVDACLVATGRIPATDNLGLEAISVDTDRRGFIPVNDRMQVLSQGEVVPHVYA
    IGDATGKMMLAHAASAQGIVVVENICERPRDVNYRSIPAAAFTHPEISFVGLTEPQAKELAKTEGFKINTVRSYFKANSK
    ALAESEADGLAKLIYREDTGEILGGHIIGLHAADLIHEVSNAVAQGQPVQSLSHLVHTHPTISEVIDEAFKRAATGFAH

    >gi|158337565|ref|YP_001518740.1| methionine-R-sulfoxide reductase, putative [Acaryochloris marina MBIC11017]
    MKRRALLKVGTVVMGTTGFSSFLPKWLSGKAMAAEVFEVTKTEEEWRQTLTPEQFHVLREKGTERPRSSLLDKEYGEGLY
    RCSGCDLPLFTSATKFDSGTGWPSFYAPIKGAVDTSTDYVLVLPRTEVHCRRCGGHLGHVFNDGPRPTGKRY
    CMNGVSLK
    FVPGEST

    >gi|158337845|ref|YP_001519021.1| thiosulfate sulfurtransferase, putative [Acaryochloris marina MBIC11017]
    MSQYAHPEVLVDTQWLMEHLNDSNLRILEVDMNPEAYNDAHIPGAVFWPIAELMRPDLSLNLDPVAFSALLGKSGINAHT
    TVVAYGSYPGTGAFLFWLFRLFGHPNIVVLNGGYQQWIAQGGAVVSELSTFPATEYRVQGPDANLRVLSAEVLAALERPD
    QILLDVRTEAEYTGELYLMEPPQGDEVGGHIPGAVHLDHAETLNEDGTFKSADELHTLFQQQGITPEKEIFPY
    CAIGGRS
    AYIWFVLTYLLGYPQVRNYDGSWQEWSRLPNVPIDQG

    >gi|158337880|ref|YP_001519056.1| redoxin domain-containing protein [Acaryochloris marina MBIC11017]
    MVLTASTMLDLGTPAPNFQLPDVVSGQTISLETFAHRNVLLVMFICQHCPFVKHVQAELAQIGHDYSDQSLGIVAISSND
    IQSHPLDDPEHLTAMATSLGYNFPICFDEHQDVAKQYTAACTPDFFVFDAHRKLVYRGQLDDSRPSNNLMVTGEDLRGAL
    DAALAEQPISANQKPSIGCNIKWKPGNEPAYYG

    >gi|158337952|ref|YP_001519128.1| thioredoxin [Acaryochloris marina MBIC11017]
    MSSTTAINDTTFTAEVLESQQPVLVDFWAPWCGPCRMVGPIVDDIAADYQDQVKVVKFNVDESSDVASRYGIRSIPTLIV
    FKEGQPVETLVGASPKATLVESLDKHL

    >gi|158338006|ref|YP_001519182.1| glutaredoxin related protein [Acaryochloris marina MBIC11017]
    MTPELKERLDSLVQTNKILVFMKGSKLMPQCGFSNNAVQILNSLGVPYETVDVLEDYDIRQGIKEYSNWPTIPQVYINGE
    FVGGSDVLIELYQQGELQQLVEVALAS

    >gi|158338023|ref|YP_001519199.1| thioredoxin reductase, putative [Acaryochloris marina MBIC11017]
    MQNGSKSQCSIRSRYLTVLMSEAIENLVVIGSGPAGYTAAIYAARANLKPFMFAGYQAGGLPGGQLMTTTEVENFPGFPD
    GITGPQLMDRMKLQALRWGSEIVTEDVISVDFQQFPFVIQSEERTVKAHSVVIATGATAKRLGLPSEKEFWSRGISA
    CAI
    CDGATPIFKNEELAVVGGGDSAAEEAVYLTKYGSHVHLLVRSEQMRASKAMQDRVMRNPKVTVHWQTEVVDVFGDTQLQG
    LKIKNRQTAEIQELQVRGLFYAIGHQPNTQLFTQQLDLDKTGYILTQPDSVSTNIFGVFAAGDVQEHEFRQAITAAGTGC
    MAALLAERWLSSQDLINEFHQSEASEQTEDGTHPPEYKLSAAFDPNTTRHQGAFALRKLFHESDRIIVVKYASPT
    CGPCH
    ILQPILSRVIDEFEGQVHYVEIDIAEDPDIAESASITGTPTVQVFQDKSLLREFKGIKAKQAYRDAINELLAATS

    >gi|158338101|ref|YP_001519277.1| methylated DNA-protein cysteine methyltransferase [Acaryochloris marina MBIC11017]
    MPPPNTIASEIDTYDRISDAITFIRQHHLEQPNLSTIAQHVNLSDYHFQRLFTQWAGISPKRFLQYLTLDYAKSRIDQSQ
    NLLALTAESGLSSPGRLHDLFITLEAMSPGEYRAGGAGLNIRYGIHETPFGYCLIALTPRGICNIHFLPSADEQASQKQL
    QTDWPQAKIIRDQTATGNVCDQVFAASPSSPLALHLKGTNFQIQVWQALLRIPQGELTTYQTLATAMGKPTAARAIGNAV
    GRNPIAYLIP
    CHRVIRRTGELGGYRWGCDRKAAMLGWEASQIKE

    >gi|158338190|ref|YP_001519367.1| hypothetical protein AM1_5083 [Acaryochloris marina MBIC11017]
    MTYLESAAKFYSQVAETPEVGLCCVQSTPLQLPGLVVPPQMQEMNYGCGTTVHPTELSGNPTVLYVGVGGGLEALQFSYF
    SRRPGAVVAVDPVDEMRKAAARNLEIAAKENEWFDTSFVTIKEGDAFALPVPDNSVDVVAQNCLFNIFEPEDLSRALHET
    YRVLKPGGRLVMSDPISTRPIPEHLQQDDRLRAM
    CLSGALTYEQYVQRIIHAGFGQVEIRARRPYRLLDQENYKLDQHLL
    LESLDSVSFKVDIADDGACVFTGKMAVYTGPEEYFDDKAGHILSLGIPLAV
    CDKTAAKLAKAHPQAIMITDSTWYYDGGG
    CC

    >gi|158338257|ref|YP_001519434.1| hypothetical protein AM1_5153 [Acaryochloris marina MBIC11017]
    MTIQVYGIPTCGTCKKALKWLQENQLEFEFINTKEEPPSIQQISAWVDTFGSKPMRNTSGGAYRALGEQKKTWSEDQWIA
    AFAEDAMLLKRPLILKDGAPVLVGFRASDEVLKERLSL

    >gi|158338454|ref|YP_001519631.1| methionine-S-sulfoxide reductase [Acaryochloris marina MBIC11017]
    MIKRWFAIALLSLITWLGPVSMAAQAQDLAKATFAGGCFWCMEKPFDVIDGVVSTTSGYTGGKKLNPTYKEVSSGKTGHA
    ESVQVEYDPSKVSYETLLEAFWTNVDPLDAGGQFCDRGDQYRTNVFYHSDEQKALAEKSKAEIDNSGKFATPIVTEIVAA
    ETFYPAEDYHQNYYQTNSNWYRFYRYSCGRDQRLAKLWGEENS

    >gi|158338534|ref|YP_001519711.1| bacterioferritin comigratory protein [Acaryochloris marina MBIC11017]
    MALTAGTAAPAFTTKDTNGNTVSLADYAGKTVVLYFYPKDDTPGCTKEACSFRDNYTAYQGKDIVVFGVSGDDEGSHQDF
    TSKFNLPFPLLADVDHSLMKAYDVDGGGYAQRVTYVINGQGQIDKVYTSVNTDTHATDILADLGL

    >gi|158338541|ref|YP_001519718.1| thioredoxin [Acaryochloris marina MBIC11017]
    MSTVAYIQDNEFEQLLKDESILVIDFTATWCGPCKQVSPMMDKLATDYDGRAKVTKVDVDKNKGIAKQFGIRSIPAVLVF
    KSGELVETLVGMSPYEKFTSAVDKHL

    >gi|158338591|ref|YP_001519768.1| Alkyl hydroperoxide reductase/Thiol specific antioxidant family protein [Acaryochloris marina MBIC11017]
    MSLRLGDTVPNFTQDSTAGTIDFFEWAGDSWVVLFSHPADYTPVCTTELGSVSKLKPEFDKRHVKTIALSVDDAQAHNGW
    IGDINETQNTTVDYPILADADKKVSDLYDMIHPNANAKVTVRTVFIIDNNKKLRASITYPPSTGRNFNEILRVIDSLQLT
    DNYQVATPVDWQDGDDVVVAPTIPTEEAKQKFPKGVTEIKPYLRMTPQPNK

    >gi|158338671|ref|YP_001519848.1| glutaredoxin 3 [Acaryochloris marina MBIC11017]
    MTAKVEIYTWAACPFCIQAKQLLDSKNINFTEYGIDGDEMARSEMAERAFGRRSLPQIFINDEHIGGCDDLYDLEGQGKL
    DPLLQT

    >gi|158338829|ref|YP_001520006.1| iron-sulfur cluster assembly protein [Acaryochloris marina MBIC11017]
    MIQLSPTAIGELKRLQRKHLPGGQLRIVVDASGCKGLAYQMQFAESPQPDDQVFDCEDIQVVVEKASMKYLSGLTLDYTE
    DLMGGGFRFYNPNAIETCSCGHSFAIAG

    >gi|158338961|ref|YP_001520138.1| hypothetical protein AM1_5878 [Acaryochloris marina MBIC11017]
    MSYPSKTSAEPSVTTFDEFVQLADYSLMDTLNADPDATVDGDDHRARQVFSGHFVPVAPKPLAEAEYVTHSSTFFKELGL
    SNELALNEKFRHVFSGDITAAHEPMRQVGWATGYALSILGTEYTQQCPFGTGNGYGDGRAISVFEGIINGQRWEMQLKGG
    GPTPYCRGGDGRAVLRSSVREFLAQEYMQALGVPTSRSLTLYVSKSETVKRPWYSQNSYSADPDVLMDDPVAISTRVAPS
    FLRVGQLELFARRTRNNAHPKALEELSMIVSHLMEREYKSDINQNLGFADQLVELAKLFRQRLTSLVANWLRVGYCQGNF
    NSDNCAAGGFTLDYGPFGFCEVFDPWFQPWTGGAEQFSFFYQPIAAEANYYMFWKAVRPLLEEDADALEQFDQVGRGFSE
    AMQQQVQKMWAAKLGLTEFNPQLLKTLIQLMTDSEVDYTIFFRELSHIPEDISALKKSFYGKTSQQLDEQWQSWLKSWRD
    LVIKDGNLAEISTNMKLTNPKYTWREWLIVPAYQQAMQGDYTLVKELQEVLSYPYDEQSQEVEDKYYRLRPKAFFNAGGV
    SHYS
    CSS

    >gi|158339030|ref|YP_001520207.1| hypothetical protein AM1_5949 [Acaryochloris marina MBIC11017]
    MTKFHLRTEQVLQGDFTLQPLNLILIFQVNCPGCFIYALPLAAKLHEKYCDRINILGLSTTFEDFELNTVANTLKLLQSG
    EMVGVTQQYFQQKQIERYAIPLKFAIAFDREIFHLNFLPGTPSWVLFDQDRNVLSSWFGHRPEEEVESLLSPYFENAVSI
    Q

    >gi|158339081|ref|YP_001520258.1| Alkyl hydroperoxide reductase/Thiol specific antioxidant family protein [Acaryochloris marina MBIC11017]
    MVHPLGLYNWDEISLIALGEEQKSHIQTKSMAIKVGNSVPDVTLQTPTGETVSLKNFLGEKIVVLYFYPKDDTPGCTKEA
    CGFRDSYTVFQEAGAEVIGVSNDTPNSHQQFANKYQLPFTLLSDGANQARKAFGVPSTLGLLPGRVTYVIDTDGVVRHIF
    NSQLNFQGHIDESLKIVQSLTKDA

    >gi|158339164|ref|YP_001520341.1| methyltransferase [Acaryochloris marina MBIC11017]
    MTTSTQFWDKIAEKYAKQPISDEAAYQKKLQITREYFQPSMNVLEFGCGTGSTAIAHAPYVHHIQAIDFSSKMIDIAQAK
    AAAQNILNVTFEQASIDELNVPDSSYDAVLGLNVLHLLENKEAAIAQVHKMLQPGGCFITSTV
    CLGDTMAWFKLIAPVGK
    VLGLFPLVKIFTVKDLETSLTDAGFEIDYQWQAGDYQSPIGNAKILFIVAKKPA

    >gi|158339653|ref|YP_001520660.1| glutathione S-transferase, putative [Acaryochloris marina MBIC11017]
    MKIVSFKICPFVQRVTALLEAKGIDYDIEYIDLSHKPQWFLDLSPNAQVPILITDDDDVLFESDAIVEFLDEVVGTPLSS
    DNAVKKAQDRAWSYLATKHYLVQCSAQRSPDAKTLEERSKKLSKAFGKIKVQLGESRYINGDDLSMVDIAWLPLLHRAAI
    IEQYSGYDFLEEFPKVKQWQQHLLSTGIAEKSVPEDFEERFTAFYLAESTCLGQLAKSKNGEACCGTAECTVDDLGCCA

    >gi|158339707|ref|YP_001520714.1| hypothetical protein AM1_A0055 [Acaryochloris marina MBIC11017]
    MDFKIYTLETAPDESKGALQQAEQTFKFIPNLEGILAESPATLKSGMALWDLFETTSFTPIEQQVIYLTANYEHECSYCV
    AAHSGLAKMVGMSAEDIEAIRNGKPLIDQKLQALRHFTKRMISERGWVGDEEIEEFLAAGYTRQQILEVILGIAVKVIHN
    YTNHIAKTPLDKAFQPYTWSKPSVP

    >gi|158339561|ref|YP_001520950.1| peroxidase/ antioxidant protein [Acaryochloris marina MBIC11017]
    MTLQLGDTVPNFTQKTTEGDLNFYDWAGDSWVVLFSHPADYTPVCTTELGSVAKLKSEFASRNAKVIALSVDDVNSHKGW
    INDINETQNTVVNYPIIADADQTVANLYGMIHPNANAKVTVRTVFVIDPDKKLRLTLTYPPSTGRNFNEILRVLDSLQLT
    DNYSVATPVDWTDGDDVVVAPSISTADAKQKFPKGVNEIKPYLRMTPQPNR

    >gi|158340004|ref|YP_001521174.1| glutaredoxin 3 [Acaryochloris marina MBIC11017]
    MANIEIYTWSTCPFCRRAKQLLDQKGATYTEYQIDGDEAARDQMVARGTNGRRSVPQIFINDQHIGGSDDLYALERQGAL
    DKLLGSTEVLV

    >gi|158340005|ref|YP_001521175.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Acaryochloris marina MBIC11017]
    MQLTRQTVNQHTDQIYDVLVVGGGAAGLSAGIYLQRYLLSTLIIDKGKARSFWMQELHNYLGLPPDTPGREVLKQGKEHF
    LSLEGDYLNAYVEEIIDEGETFAVKVRIGRKNPTYEVFHSRYLIAGSGIIDHLPQLADMKNVFDYAGHNLHV
    CLICDGYE
    MRDQRVGVFGSSEGSLQVAFPLGWFTPHITLFTNGLFEVGHEMRERFTEAGYTLNERPIRQFLGENHQMSGVELDDSSVV
    ELDAGLISMGSNYHADYLKGIELEYNGGNLVTDSMNRTSHPRIFAVGDLKVGMNQVVIAAADGANAATQIWRDIRRAEGT
    RRTAA

    >gi|158340505|ref|YP_001521499.1| methylated DNA-protein cysteine methyltransferase [Acaryochloris marina MBIC11017]
    MGLRRLTPEDDPSDHYQMVAAAIAFIREHRFEQPALSTVAQHIGLSEYHFQRLFTYWAGISPKRFLQYLTIEQAKATIAQ
    TDSLLTLSEDLGLSGPSRLHDLFVSIEAMSPGEYKNGGEGLEIYNGSHNTLFGTVVIATTKRGICSLQFQDKATLPVDDL
    LTNTWPNATLTVDQEKTQGLCDRIFLPEMSQPTKPLTLLVKGTNFQVQVWRALLQIPLGGLTTYQTIAEMIERPKAARAV
    GTAIGKNPIGYLIP
    CHRVIRGSGEIGGYSWGLDRKQAILGWEAAQLNHSTIQEGS

    >gi|158340514|ref|YP_001521508.1| hypothetical protein AM1_C0059 [Acaryochloris marina MBIC11017]
    MSLNSYSCETELMDFKIYTLETAPDESKGALQQAEQTFKFIPNLEGILAESPATLKSGMALWDLFETTSFTPIEQQVIYL
    TANYEHECSY
    CVAAHSGLAKMVGMSAEDIEAIRNGKPLIDQKLQALRHFTKRMISERGWVGDEEIEEFLAAGYTRQQILE
    VILGIAVKVIHNYTNHIAKTPLDKAFQPYTWSKPSVP

    >gi|158340880|ref|YP_001522048.1| methyltransferase, putative [Acaryochloris marina MBIC11017]
    MAQLKHWLFADLHGTVLELGPGAGINLSYYPPDINWIGIELNPFLHPYIRQEADRQGLSSINVFKGTAEQLPVADNSIDT
    VVSTYVLCSVTQLEECLSEIQRVLKPGGLFVFLEHVAAKPMTLERRIQEAVKPLWKTLLHN
    CHPNRETWKTLEKAGFEWV
    HYQHFRLSLPVVSPQIVGKARKSLETTLPKALALTSGN

    >gi|158340892|ref|YP_001522060.1| rhodanese family protein [Acaryochloris marina MBIC11017]
    MLTPKDQFFTNPISLMGSFQRGKTMTFAMHNLKEIDALTLKQWMDRNEVLLIDVSKPQEFEKSHIPGAKLIPIDKFDPAT
    VPRLQGQRIVLQ
    CQSGDRSTQAAHQMLQAGFSHVHHLQGGLAAWKAAGYPTQGKRSINILRLAQILTGSCVLLGTSLGST
    LSPWFVLFSIVVGGSLVLIGVSND

    >gi|158341272|ref|YP_001522364.1| hypothetical protein AM1_F0058 [Acaryochloris marina MBIC11017]
    MLSVVFEALSSTSSEFDCFVNFYVRSPWGGPTPYCRGGDGRAVLRSSVREFLAQEYMQALGVPTSRSLTLYASKSETVKR
    PWYSQNSYSTDPDVLMDDPVAISTRVAPSFLRVGQLELFARRARNKAHPRALEELSMIVSHLMEREYKSDINQNLGFADQ
    LVELATLFRQRLTSLVTNWLRVGYCQGNFNSDNCAAGGFTLDYGPFGFCEVFDPWFQPWTGGAEQFSFFYQPIAAEANYY
    MFWKAVRPLLSEDADALEQFDQVGRSFAEVMEKQVQKMWTAKLGLTEFNPELFKELMQLMTNSAVDYTIFFRELSHIPED
    VSALKKSFYGKTSQQLDEQWQSWLKSWRDLVIKDGNLAEISKHMKQTNPKYTWREWLIVPAYQQAMQGDYTLVKELQEVL
    SYPYDEQSQDVEDKYYRLRPKAFFNAGGVSHYS
    CSS

    >gi|158335140|ref|YP_001516312.1| aldo/keto reductase [Acaryochloris marina MBIC11017]
    MRYRRFGQTNLHLSVFSLGTMRYLQSAQNAEATLKRAFELGINHIETAQGYGKSEVYLGQMVQALGLAREEGCYLPKPCQ
    GEAKRLYLTTKITPKSDAQTMAQAIDLSLERLGLETIDCLAIHGLNTPEHLEWIKDPQGCMQAVQAAKAANQIRHVGFST
    HGSLALILAALETDLFEFVNLHYNFFFQRNAPAVELASRKGMGIFIISPADKGGLLYTPPERLKELCQPLDPLHLNARFL
    LSQPSVTTLSVGAAKPEELDWPLAIADQIHPLTEQEQQILDRLQAQAQTLPDLCQQCHA
    CLPCPEDINIPEILRLRNLTL
    AYDMEDFGRYRYRMFENAGHWFPGRRGNRCTDCGDCLPRCPEQLAIPQLLQDTHTRLQGQPRPRLWESI