Ferroglobus placidus DSM 10642 uid40863

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|288930542|ref|YP_003434602.1| methyl-viologen-reducing hydrogenase delta subunit [Ferroglobus placidus DSM 10642]
    MRIGVFVCHCGLNIARIVDVQEVVNYAKNLEDVYFSTDLKYACSDSGQEEIIKAIKENRLDAVVIAACSPKLHEHTFRKA
    AMRAGLNPYMVLMANIREQCSWVHQEHPKAATEKAKDLVRMAVAAARKLEPLSRKRIEVKKSAVVIGGGVAGIEAALTLA
    NAGVKVYLIEKAPTIGGKMATLNEVFPTNDCSI
    CILAPKMSEAFNHENIEVITNAEVLEVSGHVGNFKVKVRKHPRYVDE
    NKCKGCIDDCSSVCPVEVPNEFDYTIGVRKAIYLPIPQSTPLYAAIDWEHCIGCRLCEKACEPKAVDFNQKPEDLEIEAG
    VIIVATGYKPFDARRKEEYGYGVYKNVITTLELERLLSASGPTLGNLYRPSDSSVPRKIAFIQCVGSRDVKTNKYCSRVC
    CMVSIKNAYIIKERYPEADVSVFFIDIRAFGRMYEEFFARAQEKGIRFIRGRVAEIYELENGNLILTYENTLTGEIKEEE
    FELVVLSIGMEGNTDLANKLGISVGEDGFYDVAHPKLRPAETDVKGIFLAGAASGPKDIQDSVASAGLAASKAMELIFGG
    EAEFDPYNAYVNEEKCIGCRICEEVCNFNAVTFENKKAKIDPNACVMCGVCAASCPADAIDLGFFKEDAIVAMIDALAEE
    KKVEPLILIFACHF
    CSYGALDLAGTTKTQYSPNVRVIRTLCSGRVDPEWILRALKRGIDGVMVTGCRLGECHFRVGNYHA
    VDRIKALKKLLEEIGINPERVETSWHSAGEGAEIAKDIDEFVERIAKLGSIYEEVAR

    >gi|288930543|ref|YP_003434603.1| 4Fe-4S ferredoxin iron-sulfur binding domain protein [Ferroglobus placidus DSM 10642]
    MIERDVEMEENKFIFIQRAEDEERRLIYDYKKCNGCGICVYACPINAIELGPVHDIALGLEMPPITLDHIKCSYCGICYA
    FCPFNAFDFYINEKRVEKQELPLTLSGETRIDREKCVNCTLCFKVCPTNAISLDFKIKREDIPQRNEGVEGKVEIDREKC
    NLCGICAEFCEVFQMVEKEPHPEDVMPYEDILIDETKCDYCKLCERVCPEEAIRVEGKLIEADVSDYAFVDVNNEECSRC
    SYCEEVCPYDAITVSKPIYGELYLYEPRMYRCDPVGCGACIKVCKHNRVWYVSKDKGRVHYNEKFCNYCGACENSCPYDL
    IAVKRDAVFTIENIKNEPWRESWEEAVYRITRKIRAEEPRVKFAKVSQKFEVKEEEFKVFKPTEDILKKLEEKISLAEKI
    LKRAAIRKAIEEERFEDFAKLVKKYASRELERKEEQEA

    >gi|288930558|ref|YP_003434618.1| thioredoxin [Ferroglobus placidus DSM 10642]
    MKVLNKENFYDEINKDKLVVVDFWAEWCMPCHMLAPVLEKLEKEFKDVEFAKLNTDENPEIAMQYGIFSIPTVLMFYKGE
    IVNSFVGAMPESVVRREIEKALEKVKNEGN

    >gi|288930559|ref|YP_003434619.1| redox-active disulfide protein 1 [Ferroglobus placidus DSM 10642]
    MKFLMNNKSIFTDFDKTDKMLYIPPLEVKMEVRKMVVIKLLTSPTCPYCPRAREVLRKFAQERDDVIVVELSVTTEEGLK
    EAMKYGISGVPAIIINDRYVLLGVPRIEELRRLVEEAKGVIA

    >gi|288930618|ref|YP_003434678.1| cadmium-translocating P-type ATPase [Ferroglobus placidus DSM 10642]
    MKRYKLKNLDCATCALEIEEELKKQDGVKFAAVNFATSELVVDAEDHEKVVETVKKVEQEVELESIEKEEELDVNKKREI
    GIILTSAILFAIGTIFNEQLHAIFPAEYVVLLTSYIIVGWKIIWKGITNLKNKVVFDENFLLTIATLGAIAIHELPEAVA
    VMLFFRVGEFLQDLAVDKSRRAIKALVEIKPTFANLKVNGEVRRVKPEEVKVGDLIVVKPGEKIPLDGVIVEGNSVVDTS
    ALTGESKPRDVAVGDEVLSGMVNISGLIVVKVTRSFSESAVSKILKLVEEASSRKAKAERFITRFARYYTPAVIALAAVI
    STIPPIAFNEPFSPWIYRALVLLVISCPCALVVSIPLSYFASIGKAARIGVLVKGSNYVDRLTSTRIFAFDKTGTLTKGS
    FKVVGIVTKNGFKEEEVLKLAAIAEKNSNHPIAKSIVEAYGEVRAEVKSHKEIPGRGVVAELDGTKIAVGNDAMMHELNV
    EHECFRDETVVHVAVNGKYAGYIIVSDEPKEDAKKAIEELKKSGCKVVMVTGDSKRVAERIAKELGVDDFYAELMPWQKV
    EVIEELKKKYDSVAFVGDGINDAPVIARADVGIAMGAMGSDAAIEIADVVVMDDKPSKVSESLKLSKRTQRIVWQNITFA
    LAVKGIFIALGSLGLATMWEAVFADVGVTLIAILNSMRLLR

    >gi|288930640|ref|YP_003434700.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Ferroglobus placidus DSM 10642]
    MKVAIVGGGAAGMSAASRIKRLNPKMDVHVFEKSNFVSHAPCGIPFFVSGIVRDVEELCAYTADFFREERKINVHLNAEV
    VDIEYGKLEYVERGKSRTYEWDYLLFSTGASPIKISSSKKVYYVRSIEDAPKIRAVAEKSEKIVVVGCGYIGVEVVDALT
    NLGKKVVVIEKEYPLPDHDLEISKLLLNEMSKYAEVKSEEAVEEVREVGEKLIVETRENEYEADMVISAIGVKPNVELAK
    KLGVKLGESGAIRTDPFLRTNVENVYAAGDCAETTNIVTQKPDWIPLAAPANKMGFVAGSNIAGKRMKFPGALKSQMTSF
    KDLEIGKTGLSEKEAKKHGFDAISVTITSRATAKYIPNGELTVKMVAERNGRVLGVQAIGKGVAKRIYAAASLLYKNAKV
    EDFFFVDLPFYPPKSPVWDPLVVAARKLMKSI

    >gi|288930726|ref|YP_003434786.1| alkylhydroperoxidase like protein, AhpD family [Ferroglobus placidus DSM 10642]
    MVRPLSDEELPAELLRFLKDRFGSKIPTAYRVLARFPDLLFKFVEFRDEIMKKGRVERVLKEKIALKVSEVNDCNPCYVS
    HKRKLEALGGREDAEDEREKVLLEFVEKAVLNRGKVDSSLEKLLRFFDEDEALEVCLVVSLYMFLNTFNNLVVKNRSFQI
    H

    >gi|288930845|ref|YP_003434905.1| hypothetical protein Ferp_0455 [Ferroglobus placidus DSM 10642]
    MRPIRSKATLVFVFAILLSAGLAFYIYTLNADVINKIKPHPHQNTSVYFFYSHYCPHCREVMPYVEDVAKKVEKNGVSVT
    FCSVDETMPQSCKRVAKDIHLSAVPTAVVYSNGSKTLLVGSDEVRTLGKVLGVEQ

    >gi|288930853|ref|YP_003434913.1| Thioredoxin domain protein [Ferroglobus placidus DSM 10642]
    MGLLDKLFGREQDEEDAGPFDVESFSELNRYLKDNRCVVVEFWMRGCSPCKAMDAIVKRLAKEYRGKVMFLKSHFRTEIA
    DKYKVKSVPTFLLFVDGKVRKKKRGAMSYEAFKNWMSGCVR

    >gi|288930968|ref|YP_003435028.1| DSBA oxidoreductase [Ferroglobus placidus DSM 10642]
    MRMWILVVLGLVAGIAAGYAAGVMVGMGGKQVCTWNAGSGTGTAISEQQLNKTVEKVVKTLQSLIPVNVSVRATKVEPYG
    KLYLLNLEFYNKSGVIATQQMFMVGNGSMLLSSSPSCAVNISELSARAQQTPSAQAAVNVSADDDPWRGNESASVVIIEF
    SDYA
    CPYCAEFANDVEPKILDNYGDRVKIVFRDFPVHGEISYLAAEAADCAGEQGVKEGQGWSKYWEYHDLLFANQQEWI
    ENTTKLYDYAKQIGLNTTAFKACLDSGKYRSEVEKDLQDGRNYGVTGTPTFFINGQKVEGLTPYEVFARFIEQELK

    >gi|288931130|ref|YP_003435190.1| heavy metal translocating P-type ATPase [Ferroglobus placidus DSM 10642]
    MSRKVKKVKITGMSCASCARVVESVLREVEGVKDVKVNLANESAVIELEKDVSIKELAEKVEKAGYGVVLPEKVVNVRIG
    GMT
    CSACAKTIERALSNLPGVKSVSVNLATETAKVVFVPEETSLEEIRKAIEEVGYRFLGISEEEKIEKEDHIKVLKKKL
    AFAAVIGSILLVIQYGKFVGFQLEKELIGVVQFLLAAPVMVYSGKDMFLSAIRSLRHKNLNMDVMYSLGVGSAFTASVFS
    TLGFLPEDYLFYETAVLLLAFLLLGRTLEAIAKGKTSEAIKKLIGLQAKKATVVRDGKEVEVDVGEVRVGDVIVVKPGEK
    IPVDGIVIEGESYVDESMITGEPIPNLKRVGDEVVGGTINKNGVLKIRATRVGSETVLAQIIKLVEEALGSKPPIQRLAD
    KIVTYFIPVVLSIAIGSFVYWYFIAKAPALFAFTTLVAVLVIACPCAFGLATPTALTVGMGKGAELGILIKNGEALEIAR
    KVSVVVFDKTGTLTKGKPEVTDVIAFSDGGEREVLKIAASAEKRSEHPLAEAILRKAKSEGIEIEEPEKFEFLAGKGVVA
    SLNGDRILVGSRQLMIEKGLSFDGKVEEVLRKLEEEAKTAILVALNGRIVGVIGIADTIKETAKEAIEELHKMGKKVAMM
    TGDNRRVAEAIARKLGIDEVLAEVLPHQKAEEVKKLQEKGEIVAFVGDGINDAPALAQADLGIAMGSGTDIALESGDIVL
    MRDDLRDVVAAIQLSEKTLSKIKQNLFWAMIYNTSLIPVAAGALYPIFGVVFKPEFAGLAMAMSSVSVVTNSLLMKNYVP
    PIKRKERG

    >gi|288931162|ref|YP_003435222.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Ferroglobus placidus DSM 10642]
    MEEYDLIAIGTGSAMSVVEAFLALNPEAKVAVIDKDEPGGICLTRGCIPSKILLYSAEVAREVRRSKEFGINARIDGIDF
    RKIMERMRRIIGEDVKMIEEGLKNSPNIDYFREVAEFVEPYKLKVGDKVISSKRIIIGAGSKPLIPKIEGLEEAGYLTSD
    TLLKLEEMPESLAVIGGGYVAMEYGNFFAQLGCDVKIVEMADRILPNEELEVSKFVERKMREVAEIRTRSRVFKVEKRGD
    RKVLLVERDGKTEEIEAEEILVAVGRAPNSDILKPERGGIETERGWIKVNEYLETSLAGVYALGDAIGKHMFKHVANYEA
    KVVIYNAILGKKMKVDYRVVPHAVFTYPEVASVGLKEEEALEKFGKGNAFVGFFRLEETGKGIAMNEEGFVKLIVKRDGE
    ILGCHIAAKNASILIQEVVLAMEHNLSVFDLAESMHIHPAQSEVVMWAASNLMSVDEYSKIKEEMVNA

    >gi|288931175|ref|YP_003435235.1| hypothetical protein Ferp_0791 [Ferroglobus placidus DSM 10642]
    MKEKRPLPIFAMALVLFGVAAIFFGVNEYEEYPIKFYSLEEGFKVAKMENKLVLVYIHSDTCYVCRAFLEDLSKYEDLQK
    TFEKFVVVKVDFLTERALAVKFGATGTPEFHVFYPNGTPMKINGVRAVYIGYAGSPDDEKARKSLISFLETALESYDRR

    >gi|288931176|ref|YP_003435236.1| Rhodanese domain protein [Ferroglobus placidus DSM 10642]
    MSGKLITAFAIGIVAAFLLYNSFVLFPKEKAFKSVSPEEFYKLMQNEEAFVIDVHVPEQKHLNGTDAWIPYDRIEEFKDL
    LPKDKNTPILVY
    CRSGQMSKIAASKLAQIGYKNIYELDGGILAWQRANLPY

    >gi|288931219|ref|YP_003435279.1| fumarate reductase/succinate dehydrogenase flavoprotein domain protein [Ferroglobus placidus DSM 10642]
    MKIGLYICHCGRNIADVVDVKNLIEYFKDKVNVVRDHLFMCSEPAWEMIRSDVASKLVDRVVIAACSPQNHEKFFRSALE
    TAGLSKYLLEIANIREQCSWVHGKNKEEATEKAKRLIKAAISKVKTLKPLEDLKFEVERSVLVIGGGIAGMTASLDLAKM
    GFKVYLVEKEPSIGGKLIKFDKIFPLNDCAS
    CVVSSLMAEVANNPMIELITYAEVEEVNGSFGNFNVKVRKKQTYVDWEK
    CIGCGACTTVCPPKAWKPNEFDEGLSKRAAMYIVSPQAVPKKAVHDPELCVNCGKKKLGTRRFLRGGKEYLTPCEKACPT
    KAIDRSKSWNPKGEILNFNVGAIIVATGYKVMEKETFKEYASHSPNVITALQFERILSPTGPTSGKILRISDGKKPKAIS
    FISCVGSRDVRYHTYCSKVCCLYLLKQARLVKEREPDIDVYIHVIDVRAPGKDLEEYYIEARRMGIGIIRGKVGGIEELP
    NGRLRILGFDADLGMPIEVEVDLVVLATAIELPEDSRELARKIGLTVDPSGFLKEDHPKLRPVESTLTGIFLAGCCQGPK
    DVSETVAQAKAAAASVASLLNKEEIQVEPFIAKVNEEACTACGICENVCPFNAIKVKEVAIVDERSCKGCGICASCPAKA
    IDIQGYSAESITAEIEALVG

    >gi|288931641|ref|YP_003435701.1| glutaredoxin [Ferroglobus placidus DSM 10642]
    MVKVYALTTCPYCKKTKKFLEENGVDFEIIYIDKLSGEERKKVVEEVHKLTGMYAVPVTVHGDKVIVGYKEDELKKLVEE
    LKK

    >gi|288931689|ref|YP_003435749.1| Rhodanese domain protein [Ferroglobus placidus DSM 10642]
    MKLVRILLIFSLIFAGCLQAEKGIYKDISVDEAYELIQKNKNNPNFVILDIRTPEEFKSEHIDGAINIDFYSPNFKEELK
    KLDKNKTYLIY
    CRTGHRTSLAMPLFKELGFKEVYNMLGGITAWKNRGYPVVR

    >gi|288931879|ref|YP_003435939.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Ferroglobus placidus DSM 10642]
    MKVAIIGGGAAGMSAASRVKALKPEWEVSVFEATSFVSHAPCGIPYAIEFDFGSEELMYYKPEVFVKERGIDLHLNAKVV
    EVDYGKLRVEENGKEKTYEWDKLLIATGASPKVPKIEGVDLENVFTVDLPPDADRIRRAAKEAENVVIIGAGYIGVEMAE
    AFSAINKKVTVIEFLDRPLANFDREISNIVKEEMEKKVELKLEESVEAIEGKDKVEKVVTNKGEYKADLVILATGVKPNV
    ELAKQLGVELGETGAIKTNSKMETNVENVYAAGDCAETINLVTKKPAWIPLAPAGNKMGYVAGVNMAGGNIEFPGVVGTQ
    ITKFYDLQIGKTGLTEEEAKKEGFNVKSAFIQANTKVHYYPGAKKTFIKAVKDADTNRILGAQIAGYEMVTMRVNVFATA
    IQAGFTTRDLFFADLAYAPPFTPIWDPVIVAARVLKF

    >gi|288932116|ref|YP_003436176.1| alkylhydroperoxidase like protein, AhpD family [Ferroglobus placidus DSM 10642]
    MGNKECEEYVKERMKLMPRFLKTVCEVWPEAAKKFADFYEVIWRDGALDRKTKELIFTAIGVATASPRCIVHVIAAVEAG
    ATDEEILEAVTVGFIGAGFYPNNPGIPYAFEYAVKAIEVAQKYRRGEDWEYLKPPEFRG

    >gi|288932118|ref|YP_003436178.1| OsmC family protein [Ferroglobus placidus DSM 10642]
    MSEINGVDVEYLKQLVETVKKHPELGRTLWRARSKWKDGFKVEVNIRDFTIRMDEPKDLGGTNTAPNMVEFVLGALGACL
    VVGYVMNAAIRGIELDKVEIDVEGDIDLPGFFGLESPEKVSPGFTNIRARVFLKTKKPVSKEELKELHETVVKTSPVGNT
    LMKPVNLEVKLEERRTV

    >gi|288932140|ref|YP_003436200.1| DSBA oxidoreductase [Ferroglobus placidus DSM 10642]
    MDLSGKNLAVLAIIFVLGFAAGYAVNYGSKEKIEKSSLSEIEEKVVNFVNTNLLKPGIEAKIVNVSEEDGFYVFDLEFSK
    DGNTLGYDSVYVTKDGKYLFIGKFDLSGEVENEKAEKLIDVENEPWKGDPNAKITIVEFSSYD
    CPFCAKFALETLPKILQ
    NFSVKVVFKDFPIHGEVKAHEAANCAGEQGKYWEYHDVLFQRQEEWRKNESKLLEYAKELGLNVSEFEICLNSDKYREEV
    LKDKEEGIKLGVRGTPTFFVNGKVVEGAKPYEEFEKILKELEEK

    >gi|288932256|ref|YP_003436316.1| DsrE family protein [Ferroglobus placidus DSM 10642]
    MKVGIVVSSNDAETVWNAFRFANFALNSGDEVRVFLIGKGVECEKIEDEKFNVREQMEKFANNGGKIYACGTCLKLREME
    SACPVSTLADLYEIVKWCDKLLTF

    >gi|288932323|ref|YP_003436383.1| protein of unknown function DUF255 [Ferroglobus placidus DSM 10642]
    MANRLEKARSPYLRKAANQPVDWFEWSEEAFKKAKEEDKPILLSVGGVWCHWCHVMAKKCFENEDIAKIINENFVAVKVD
    RDERPDIDRRYQEFVFATTGTGGWPLTVFLTPDGEPFFGGTYFPPEDGFGMIGFKTLLLKISEMWEKDRESLLKSAKQIV
    ESLKKFSERDFSSNFDFTLIEKGIKAVLDNMDYVNGGIGRAPKFHHAKAFELLLTHYYFTKDEDLIKAVELTLDAMAKGG
    VYDQLIGGFFRYSTDDRWHVPHFEKMLYDNAELLKLYTIAYQITKKELYRKVAKGIVDYYRKFGVDERGGFYASQDADIG
    ELEEGGYYIFSLEEIKEVLNDEEFRIASLYFGLREGKNVLHVSLDENEISEILGIPVRRVKEIIESAKEKLLEVRERRET
    PFIDKTIYTNWNGLMIEAMCDYYKSFNDPWAVEVAEKSGERLLKFWDGDVLLHTDDVEGFSEDYIFFAKGLIALFEITQK
    GKYLNAAVEITKRAVDLFWDHKRGGFFDRKSSGNGLLSLKVKDIQDSPQQSVNGIAPLLLTTLSSVTGTEEFGALAKKSL
    RAFAGILEKYPLISPSYMISLYAYIRGIYLVKTRRHFEEMLRTFRPFKFVIRDDSELVCEGNVCRSLK

    >gi|288932369|ref|YP_003436429.1| methylated-DNA/protein-cysteine methyltransferase [Ferroglobus placidus DSM 10642]
    MPRRITEIVFVDWNPNFYAALSGKVIEFSAFTSKKLESSYESDLAEKLEKKLERYFSGKRVSFDEFKVSYPSEFSKRVLE
    EVRKIEYGKVCSYSDLAEKLGTSPRAVGVALKMNRVPVIVP
    CHRVVAKNGLGGYSHGVNLKLKLLKLEGVECACLSGRGS
    L

    >gi|288932552|ref|YP_003436612.1| UBA/THIF-type NAD/FAD binding protein [Ferroglobus placidus DSM 10642]
    MLTDEQIKRYARQIIMPEIGVKGQLKLLDSSVLVVGAGGLGSPAIQYLAGAGVGRIGIVDGDVVDISNLQRQTIHAGNLG
    MNKAESAKIFVEKLNPDVKVDVYPFNLTPENAREIIKKYDVVLDCTDNFVARFLINDACVIEEVPFVHAAVLRFEGEIMT
    VVPKESACYRCVFKHAPPPGTVPS
    CQEAGVVGATVGVLGTLQAVEAIKLLLGIGETLVNRMLHVDLLTMDFTELKLRKDP
    ECPVCSGRVKDIIPEKYVESCQL

    >gi|288932581|ref|YP_003436641.1| thioredoxin [Ferroglobus placidus DSM 10642]
    MDELEKIRKKKLMELMKKMSGEGGYQGKQAEKYPDKPIEVNSSNFDEILKKYENVVVDFWAEWCMPCRMIAPIIEQLAKE
    YAGKVVFAKLNTDENPQIAARYGITGIPTLIFFKNGKPVDKIIGAYPKGEIERWIKRNL

    >gi|288932828|ref|YP_003436888.1| hypothetical protein Ferp_2506 [Ferroglobus placidus DSM 10642]
    MRSIAALILIAVGASFLLFSFQSTPNVNFYSYEEGLKVAAKENKPILLIIDSESCVYCTIFKEDFEKYEDLKLALSKFVI
    VEVDYVRERDLAKKFGATGTPEFHFLYPNGTPITYNGEKLVMLGYSSEYRQDLINLANFAYQIYERSKAQKT

    >gi|288932869|ref|YP_003436929.1| thioredoxin reductase [Ferroglobus placidus DSM 10642]
    MEAILDIEGEKSEEREFDVAIIGAGPAGLTAAIYATRYGLKTVVFETVEASQLSLAPKIENYPGFEGSGFELLERIKRQA
    LKFGAVHKFEHVERLRKDGDYFVVKTDMAEYKAKALIIATGGKHKELGVPGEKEFVGKGVSY
    CATCDGNFFRGKRVAVVG
    GGNTAVTDAIYLHEIGCDVVLIHRRDELRAEKALQEELFKRNIPVIWDTVVLRIEGNEKVERLVLLNRKTNEESVLEVDG
    VFIAVGIVPATDIVMDLGVERDAAGYIKVDKRQRTNVPGVFAAGDCCDNPLKQVVTACADGAIAANSAFEYIKMMQL

    >gi|288932881|ref|YP_003436941.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Ferroglobus placidus DSM 10642]
    MIAIVGAGPAGISAAETLRRKTNLPITIFSAEKCPPYNPAVLTTYLKTGGDEIFWKGKDVFERLNVDARIGEKVEKLDAK
    RKKITTEIGDYEFEKIIVASGSRLYAPLKGLDLPNVYNFKSLTQVRELRSKIVRGECKKAVVVGGGFQGTEIALTLREIG
    IDVTLLEATDRIMPERLDKKASKFVEKVLEDKGVELVFNSFGTEFAADSSGVCKAVVTENGEEFPGDVFVAATGMIPNVD
    FCKEELDTAKGIVVNEFMETSQKDIYACGDVCETKNRVTGERGVFANYWNAVRQGKIAALNALGYKIPYEGSDVINSLKK
    LGFHFIVAGDVSGNNYQEVEDRGNYWRFYVKNGRLVGYIIVGDISNAGIFYRIMVSGFDIGRFGKPLFTLKDSDFASFST
    KFKYQQSHHHYR