Vulcanisaeta distributa DSM 14429 uid52827

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|307594163|ref|YP_003900480.1| hypothetical protein Vdis_0014 [Vulcanisaeta distributa DSM 14429]
    MSSSTNINRMLLVAVIVLAVALAAVLIYFLAFKTTPTQKTPSSQGSSSSSSQNSASSQLSLATTAFERGVENWLSIECIY
    SNYGENATLNAVNSIYTIAYNYIYDYEETNNVTYLLLYPIAQYQYIESNYAKCAINESDQGLVNTVLGALSNINTVAYTL
    NIPGNLLGTPLFIVFDRTNNVTYVLAGASPYVFNAINDAVRGNITVFTYQGQELGYGFRANSTQVSFIDQIISSGLRIGN
    PSANITVIEFLDPV
    CPYCALFQVMYGRSLETMINSGYVYYVIQYFPTHVLGYGCSSPTIAQMLGPYCG

    >gi|307594178|ref|YP_003900495.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Vulcanisaeta distributa DSM 14429]
    MGKRIVIIGGGAAGASAAARARRLDPEAEIVMLDKGLFISHAPCGIPYYIGGVVKEAQELAIYTPEEFAKERRITVKVNA
    EVFDVDTKNQVVYAREGNETVKYQWDVLIIATGAKPITLPVEGHDLNGILTLRLPHEAPKLREEVEKASTVAVVGGGYIG
    LEVAEALRNLGKRVLLFEMMPHVLPTTFDEDMAKLIHDELIKNGIELHLNEKVVGFRGVNGHVNKVITEKGEYNVDKVVM
    GVGVRPDVDLAVKAGAKIGETGAVWVNEYMETSVPNVYAAGDVAETWSLITGKRMYVALAPPANKMGQVAGANAVKGRFL
    KFPGVLGTAITKVFGLYVARTGLTEKQAREEGFKPVSATIKARTTAHYYPGGVQVNIKMIMDETSGRVLGVQIIGPDRIV
    AGYIDVAAALIGKGATVDDFFFADLSYSPPTAPVWHPLITAARVLSKGKY

    >gi|307594212|ref|YP_003900529.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Vulcanisaeta distributa DSM 14429]
    MLGKYPVFPPTDPEFEDPPKLDKYDVVVIGGGGGGYHGAFELSKGGLKVLMVDDKGNLGGNCLYEGCIPSKSVYMTIYLM
    EKIRGILNSVGNKDINAVRVLWENAIDHKDNVQYIRYLQHIREIKGHENVDFVKGIAEVIDEHRVRVRAIDGSWTKDVEA
    RQLLIATGSVPIKIPVPGADLAIGSQELFGYKTSYRKIPNDVVIIGGGYIGVEVASVLGSMGIKATIVEMLPRILTGWDN
    DVVSKIEEKLKSKGVEVLTNSKVIGIKEEGGQKIVEFERPDGSRGYVAGSEVIMAVGRKPYVEGLDKLGIVEKGHVDVES
    SMRTKAPNTYAAGDVIGKYMLYHAAVKESVVAAWNILHGKPIYEVNFNSIPMAIFTEPEAAMVGLNEDAAKARGINYVTV
    SYPLEDDAYAQIMGVREGWVKLIIERESQRIIGGVVYGEAASLIINEIALAVSVNARVKDIALLAHQHPTIFEAIDRAAI
    RFSL

    >gi|307594818|ref|YP_003901135.1| methyl-viologen-reducing hydrogenase subunit delta [Vulcanisaeta distributa DSM 14429]
    MNYRALDVNRVKRPLGRLKITPEMCIGDELCVKRCPMGILELTREEVNPRGYHYVRIKPGKEVDCVACGICEKVCPTNAI
    YVEHEEEITIKDYLMKIDKTKVTQESATNNRVLVIGGGIAGVEAALALAGMGYRVTLVEKSPAIGGKMAMLDKTFPTLDC
    SI
    CIEGPLMSDTSNNRNIEVLTLAELMELKGEPGHYRAKILVKPRYVTNECTKCGLCEGVCPVVVPSEYNAGIGLRKAIY
    LPFPQAEPGIYAIDPDLCLNKPPENIACNRCVSVCEPRTILFTMMPRIIEREVAAVIVATGYELEGGEVLTKYGYGKHPD
    VLTAMEFERLVNATGPSLGEVVKLSNHGHPRKVLFISCIGSRTSRANPYCSKVCCEYLLKQAIYAKNHGIDDVTILYMND
    VRTYGKGFENLYQRAVERGVRIVHGRPLVIGPVNGSIRVKYEDTRSGEVRVEDYDMVVLAPTMRPPKDMQRLANALGLEL
    DRYGFIKVNPANPVETNIPGIFVAGSASGPTDITESVLMGLAAAAQAVGFMGKSIIETEEFSETIEAEKPRIGVFVCHCG
    SNIAGIADVNELVKFSRGLPGVVHAEDIPFACSKAGLDRVAESIKRNNLNRVVVAACSPATHLRFFRDSARRAGLNPYLV
    EMTNIRNLDTWVHNDRKVATEKAKDMIRMAVAKASLMRPFRPEKLGIIKRALVIGCGPAGLAAVNALVNAGVETMVVELG
    SKCGGPYLNDFVIRYLPEGIRAKEVVNKLLKVLENPRVKVYYGTTVKDVSGFTGNFHVILSNGVELDVGAIIVATGASPV
    NTVNYKAGNGLNVMTIHDLINGGLNVGNDVLFIDLCNKPYCQAVMFNTALTLRRAGKNVYVVVRDIMMVGTQYEDLYREV
    RRAGVTILRVPRDGNVMNHVVLNHDTAVIRDVELGEDVTVRIDSVILNTPMKPNSDEVSKILRLSKDQEGFLMEAHPKLG
    PVDTMTPGIFVAGAVRAHRGFGEAVLEGYAAAARALTLLSRDYIIKEVSVPRVDPGKCVGCLLCVKACPYGAIKGEPGKP
    VTINPAACQGCGSCVGECPYGALDMDLLSDDAILAQVEAALAEEPEKKVIMFTCAY
    CSYYAADNTGILKLQYPPHIRIIR
    LPCSSRLNWRHVKRAFELGAAGVFVTG
    CRLGDCHYITANYNTVRRFENWKKRLKNIGVREERFQLRLFGAPDVKDFIEAA
    NEAKRIVETVTREEIEMTKQKIKQIR

    >gi|307594852|ref|YP_003901169.1| thioredoxin [Vulcanisaeta distributa DSM 14429]
    MGEERELIEKVYRKMIMTRLRESSVSRPMCPNGIVVLSGNSFAASIKECSASVIDFYADWCIPCKIMEPILNKLAQVFAG
    KVFFGRIDVDAYPGIAAEYGVMSIPTTILFRNGEEVYRVIGAVDYNTMRRYIEIYLGVKP

    >gi|307594873|ref|YP_003901190.1| UBA/THIF-type NAD/FAD binding protein [Vulcanisaeta distributa DSM 14429]
    MGTIQLIDRYSRQIAVIGKEGQEKLSKARVAVVGLGGLGTLVSMYLVGAGVGELVVIDYDTISLTDLHRQLLYREEDVGK
    PKVEVAVRRLRDLNSTVKIRPVSEALTSENAEDVLKDVDVVVDALDNWFSRQVLNEAVVKLRKPLVHGAVNGWYGQVSTI
    IPGKTPCLYELVQVRSLPQCVGY
    CPVVGPVVGVVASIEATEVIKLITGIGEPLINKLLIIDGKNWVVDEIKLSRVESCPV
    CSRYLKEK

    >gi|307595045|ref|YP_003901362.1| glutaredoxin-like domain-containing protein [Vulcanisaeta distributa DSM 14429]
    MSATPFEKPQGTVEVPHIEVDEETKEIIKEILSQMKNPVEILFFTSNTCGNRDTNWCVPTEELLDLLAELAPPGKLILKK
    IKYEENSDAFTKYNVEPQRVPVIYLLDGAIKYLGAPLGEEVRAFIETIVRISVGETKLRPRTKKGLEALVNSGGGKRVEV
    MTVVTPS
    CPYCPYAVLMANMFAYDSKGKVVSITVEAYEESDIADMYQVTAVPTVVLKREDQEVGNVEFIGVPPESDLLKK
    VLDYSGVNLQ

    >gi|307595103|ref|YP_003901420.1| glutaredoxin [Vulcanisaeta distributa DSM 14429]
    MLANRDAVSTPNVEIFIHPTCSTCHTLIRLLKQWGYLDRVRIIDTSRDPYTAMERGVRSVPSIFINGELVFAGIVDFKRL
    KALLDGEYLGNRFEGDLKELEERFFRGVLDSVATALWLYVNEDCDAFLRDKEFVMAITNLSVYSDREELYNELRKYLGNA
    NTCREAIRSREDRFLTVITKNFAREIYWLHNKFLSWGEVSKLYSREVIAHWMIVRSALGRVGLRAYPISNERFREKVERV
    YEYMSKTFDDYMRQVINEQTKIFSDSEYIEVIEGFMKSIKGP

    >gi|307595441|ref|YP_003901758.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Vulcanisaeta distributa DSM 14429]
    MRVVIIGGGAAGMSAASRIRRLRRDLEVVVFERTSMVSHAPCGIPYYLEGLFDNYELFMHYTPDYFRRERGIDVRVSEAV
    IEVGPNYVVTDKGNKVQWDYLVLATGAVPAIPSIPIEGSHVFTVHHPADAARLREILYSMNSIGIIGTGYIGLEVAEAFR
    FRGKDVLMIGRSGYPLRKSLDEDIGEAVKNELIKHGVKLRLNEKVLEINSQGGKQVIVTDGGKYVVDAVVLATGIKPNVE
    LAKQLNLRIGETGAVWVDEHMKTSLENVYAAGDTAETRNLITGKPYWHPFGTTANKMGFVAGSNIAGRSMVFPGVVGTSM
    TRFMNLYIASAGLTTQEALRHGFKAEGATITARTRARYYPGGGYVTIKLIVDKNTMRIIGAQVLGDDGSYVLGKIDTLAA
    LMGRGATVEDLFMSDLAYLPAVTQVWDPLIIAARQFLRG

    >gi|307595480|ref|YP_003901797.1| hypothetical protein Vdis_1360 [Vulcanisaeta distributa DSM 14429]
    MDIDERIQCLSQSRSPYVLEALNSPVKWWGWCAKAFEKAINEDKPLLIDIGAGWCHWCHVMDETTYKDPEVVQLINDYFI
    PIKVDRDERPDIDRRYQEAALLIAGQGGWPLTVFATPKGEVIYAGTYFPPRDGMGLPGMVRVLRAVLDAYRSRRDQIGEL
    IREISNAITSSYVSTVTDNLDIGVVDDVVVKIVDMYDNEHGGFGMAPKFPQVTYHALLLYRGFYTGSALINIVRETLIRM
    GRGGIYDQLGGGFHRYSVDSGWLIPHFEKLLIDNAELLMNYSEAYAITMDDELREIGVGIINYVNDTLANPDGGYYASQD
    ADVDFKDEGGYYKWSVDELRGLLSNDEFNIIYWYFGIFKFRGNEKAVLHRALSIEEVANKLGISINMARSLLNSAISKMI
    NARRQRKSPRIDTTIYAGWSSAMAIAYTMASDYMSINGVIEHSLKIIDFIMNNMYRSDGLRRAFRCNTLSLPGLLEDYSY
    TLLAALMAYSHTGDRKYLEFAIKLGNDIVDKFRAPDGGFYDTDMPDEPMTLRIKPIADTPNWSPNSLALIALMNLYRVTG
    IDKFSKEVNNGIRALYSLAMRYGPAASSYFIALDWYLRDPPKVVIVGDANDDFIRLLRMALRTFRPGKLVIPIISDSVDD
    LLMDNSIRAMVNEYRRKGSPLAYVCAYSACTTPIVNEETLRNVLTDFMRDRYA

    >gi|307595481|ref|YP_003901798.1| Rhodanese domain-containing protein [Vulcanisaeta distributa DSM 14429]
    MYVKNALIIHTYKSYYHRIFVESLTEVEDILSYLNRGFASFISSPYIVVEIDENPGAGYLSWHIPGSTLLRLYGDLLRDV
    GIIRDYEALIMDLAVKGITRDRHIVLLDEIDNRHAALAYMVLKALGFKHISLLNGGKVNWLIHKGPLCTCNGHVYSSNFN
    QRDWLNVVVNLKDYFVNFDQVYELVTNGNIGGDTLLIDVRSPCEYMGSDVDIWGHIPGAINMPWNLFLEPRTNRFRDRDE
    IVKVVDRYGLSQNDNIILY
    CRTGGRSALVWFALTELLGFSKVRVYLGSWLDWISRGAPIKRGEEP

    >gi|307595486|ref|YP_003901803.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Vulcanisaeta distributa DSM 14429]
    MTVNTRILLYVIIMVILTVVTLSLIIVLYNSSVVKVGIKVGDYAPNAQFTLDNGTTVNLSDFLHHGHYVLLYFAATWCSS
    CAYGVLTLSHYAQLLAARNVTVIILEPYNDLGYSGTPVGIFVNYFAGNNSRLFIIGYASLEMTEAYDPHGYPDIYYLISP
    NGRIIYSNVDLSNTINGLLDVVGVG

    >gi|307595489|ref|YP_003901806.1| mercuric reductase [Vulcanisaeta distributa DSM 14429]
    MKELVIIGYGAAGFAALIRANELGIKPVLIGYGPLGGTCVNVGCVPSKTVLRIGELYNYVSKVLGHEHYPEFTEVFARER
    EVVNELRRLKYEDVLAKYDVELIEGKAYFTSSSTVKVNGKVIEARRFIIATGASPKIPEIPGLKEVGYWTNVEALNPDRK
    VDSLVIIGGRAQALEFAQMYRRLGVDVAIVQRSPTLIPDWEPELALEAQRMLEDEGVLVITNAKVLRVSRGLGKVVITDK
    GEIEADEILLATGRRPNIDLNLEAAGVKLNDKGGILVDDELRTTNPRIYAAGDVIGGPMLEALAGKQGVVAVDNAVLNAH
    RRIDMMSVPQAIFTQPNLARVGLTFMEASKARINADYRVVWMRDVAKAHILGDTRGLIKIIIDKNNMRIIGVHVMAENAA
    EFIGEAALAIRLRATVDDIIDTVHVFPTMAESLKLAAQAFRRDISKLSCCVD

    >gi|307595492|ref|YP_003901809.1| Rhodanese domain-containing protein [Vulcanisaeta distributa DSM 14429]
    MGYAHPEVLVDTEWVVNHLKDPKVKIVEVDYDPSTAYFVWHIPGASLLTWKDHIRHPVRRDFVEPDQFARFMEERGISND
    TTVVLYGDYNNWFAAYAFWVFKVYGHEDVRLLNGGRTKWAKENRPTCSGHQEPHYYREAGAKYVVKRVDWGSHRVYAWEI
    LNRLNKGEVGKSLMLVDVRSPKEYTGEITAPPEYPNEHAQVGGHIPGAINIPWSLAVNPETGEFKSPDELRRLYEQYGIT
    SDKEIVTY
    CRIAERASHTWFVLKYLLGYPSVRVYDGSWAEWGNMVGVPIKKGQEP

    >gi|307595677|ref|YP_003901994.1| thiamine biosynthesis/tRNA modification protein ThiI [Vulcanisaeta distributa DSM 14429]
    MALILVRYGEVAIKGAGTRSRMERLLMHNIISGLRGIGVNAKVIKSQGRLFVEVPDDRVKEGVDLISRVFGVKSLSPVKA
    YVFKELNDIVNAAIKEWSDLIKGRRFAVRVHRVGSHNFTSMDVAKAVGAALKPFSAGVDLERPDIELFIEIRGDRAYLFT
    EVINGPGGLPLGSEGKLLALISGGFDSPVAAWFMMRRGSYVDALFCSLAYPIDVINFLRVSHVLFSRWSIGYDPRLFIID
    CSPLIGEFRAKADPHMWSVLFKRVLYEVASRVARSISALGIVTGESLGQVSSQTLHNLMAIEHGIDMPIYRPLIGLDKDE
    IMNYARRIGTYEESMRTEEFCAIFSEKPRTRVTIDELDNEFRKLDQNFINNLLNSVVTLRVSAAVKVIDELMLGTNDVEI
    DHVPENAVVIDLRSRGEYETWHYPGAVNVDVDKLVSTAESLGRDKIYVLY
    CSRGLSSRWGALELRRLGFKAFSIDIDKLR
    RSS

    >gi|307595811|ref|YP_003902128.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Vulcanisaeta distributa DSM 14429]
    MVNEGEEAPDFELQSHDGETVKLSSYRGRWVVLYFFPKAFTSGCTRETQEFARLWDEFEKLGVVVLGISTDSVSTQRRFA
    EKYGVKFKLLSDSEKRTSQAYGVLRPTGTAERVTFIVNPEGKVAKVIRRVKPEEHPVKALEFLRQSM

    >gi|307595981|ref|YP_003902298.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Vulcanisaeta distributa DSM 14429]
    MNYNLNYLRLGRHGYLIIMVEVGERAPDFELLDTELKLRRLSEFLGKRFVVILTFPAAFSPVCTKELCTFRDRMALLNKA
    NAEVIAISVDTPFTLKAFKEANRLNFTLLSDFNKEMITKYGVIHENLLGLKGVAKRAVFILDPKGIVVYKWVSDNPGVEP
    PYEEVIRIVDELNKKYST

    >gi|307596057|ref|YP_003902374.1| hypothetical protein Vdis_1951 [Vulcanisaeta distributa DSM 14429]
    MTHMGSKSLKIQVGTANLRPMWVVASILLIGALAMLIGGVIMQLVYHITLAPLWVGIFAGILLSIPLEIWDFSNPDVIIK
    AITLKDRLLMVCFGLVIGLGAILLYALNLFVPALHWGIKAFFVPGVVIGGLIFGVGVAIAGYFPGTIWIALGQGRRDAIY
    AVVGGLLGALTWSLIFGQARYFFWDTLNFGPITWPTLFGLTTKIDELIVAIVFGILMISMWLFIPRRQGGKACVLHLTGK
    TKEVMPLEDEISEFKEDYPKIPDYVIEAVSVQQPRSSRIIFALAFDFTLVAVAVIVLRQIFGESTTYAWIWSQILYFIDP
    RWAASLPYFQLFGGLKIVNGIPVDKPFSEIGWEPLSDLGTFLGGLISSVFITKRFMAFKPWTPHIWRDRFGNTPGLRALA
    SFIGAYLVLFGARMANG
    CASGHILSGNLQMAVSSFVFFIAVIIGAIITAYVLYGLKPWTSR

    >gi|307596098|ref|YP_003902415.1| heavy metal translocating P-type ATPase [Vulcanisaeta distributa DSM 14429]
    MSKVSIGLRFSNGREVHFKIIGMHCATCSLTVQKALLSVNGVLSASVSLANDEAVVIVDPAVFDYAKALKAVQGVGYDIY
    RETLTFMLKGLEPEEVNTIVRALHAPGVFSVVPNPVNHTVIITYNPLEIDEGGLRAIIENAGFKVIGVSKGGTEDFDVDR
    KAVETDLKDIKARLTVAIPLTALIFLLEALSIAGIIPGALYAIASFALSTPVQFYSGMRFIRGAVRAFRNVTANMDTLVT
    LGTLSAYVFSVLVLTHVISGDVFFDSSAAIITFILIGRYLETRLKLRVGSTMRELARLYPRSARVVRSGIETLVSINEVK
    PGDIVVVKEGEVIPVDGYVDGGEGYVDEAVMTGEPRPRHKGVGDLVLAGMVLTKGYLRIRATRSGEYAFIAQVIKQARQA
    QSLRLPIQSLVDRVASYFTWLVITAGAVTFIVWYLLGAPIYVAVLHMASVLVIACPCALGLATPISVVAGTNNALKHGIL
    IRDSRAIELSPRIRAVAFDKTGTLTRGRFEVISVIGDEKVLYYAAVAEKGSEHPIARAILERAKEVYGEIPDADNYDTIP
    GMGIIAQRNGLTIGVGNEKLVKGFEAVINLEIERKVRESASDGYTVVYVIINNEVLGAIVLGDSLRPEAPAVINELRRIG
    MVPVIITGDRTEVAKMVARKLGIEHVYAGLTPDEKAEVVKELKDKFGITVMIGDGVNDAVALKVADIGMAMGTGTDIAKS
    AGDVVLLDSDLTKVLSFIKLSRKILSNIKFNILYAFIYNAVLIPIAAGAVPGLTIRPEWAGLAMALSSTTVTLNALRLRR
    SHV

    >gi|307596220|ref|YP_003902537.1| thioredoxin reductase [Vulcanisaeta distributa DSM 14429]
    MSSAFKISVTKMDFGVSEELTSKVYDTVIIGGGPAGMSAAIYAARYGLSTIIITEEIGGQVAKSGWVENYLGYTRIMGPD
    LVNKFEEHVKYYNVPIIIDSVENVERDGDLFKVYTLNGDEYTARTVIIAVGEKKRKLNVPGEDTYNGRGVSY
    CAPCDAPL
    FKGKVVAVVGGGDSAASAALLLTEYATKVYIIHRRNQLRAQKYYQDLLLKNPKIEIIWNTVVKELQGDKLLRKAILQRVD
    TKEVFELPLDGLFVEIGAEPPVELFKRIGLALSQDGYIKVNHLMETSIPGIYAAGDCVDLTPRDFRQIVVAAGQGALAAY
    SAYNYIIRKYGFNRR

    >gi|307596225|ref|YP_003902542.1| hypothetical protein Vdis_2122 [Vulcanisaeta distributa DSM 14429]
    MSSGKDKISMIVFSGTDDRLIPVGVISQAAAALGYEVNIFFTGWAMFKLLKNPIPPVWPKEFESFVPRLQEGMARIKAPT
    WLDMLKEAKKMGAKVYV
    CSMMASAAGLKKEDFDPSLVDDIVGVTTFLEMAKGGQVLFI

    >gi|307596283|ref|YP_003902600.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Vulcanisaeta distributa DSM 14429]
    MPITIPSIGEKFPELNVMTTHGPMKLPDAFKGKWFILFSHPGDFTPVCTTEFVSFAKHYDDFKKLNTELIGLSVDTDISH
    IEWVQWIEKTLGVKIPFPIIADPLGNVSRALGMLHAESSTNTVRTVFIVDDKATIRTILYYPLELGRNIPEILRIVRSLQ
    LIDKYGVVMPANWPYNEIIGENVLNPPPHHVEEAPKRLQQFKGYAWWLTYRELPKEEVEETKRIIKIRIE

    >gi|307596381|ref|YP_003902698.1| methyl-viologen-reducing hydrogenase subunit delta [Vulcanisaeta distributa DSM 14429]
    MPTNRILILGGGIAGIEAALALANMGYRVTLVEKSPAIGGKMAMLDKTFPTLDCSICIEGPLISDVARHPYIELLAPAEL
    LDLTGSPGDFKARILVKPRYVTDDCTKCGQCEDVCPVIVPSEFEAGIGARKAIYLPFPQAEPGIYMLDIDHCLNKPPNYF
    PCDRCAKACDRNAIIYTMMPKVIERDVAAVIVSTGFDLEKGDILGEYGYGRYMDVVTSLEFERLVNASGPSSGVVIKPST
    GEEPENILLVSCVGSRNNRYNDYCSGFCCTYLLKQGIYAKVLHGIKNVTIMYMNDVRTYGKGFESFFDRALKEGINIVWG
    RPEVLGERNGKIVVRFEDTRNKKVVVNEYDMVVLAPSVKPVGDMNKLSKILNISLNRVGFVKTDPANPTLTTRPGIFVAG
    SASGPRDISESVVTGLAAAVQAIRYASPGVIEEEKYEETIEPYPIRVGVFVCHCGTNIAGVADVPALVEAAKQMPDVVHA
    EDLQFACAKSSLDRITQVIKEKKLNRVVVASCSPVTHLRFFQDSARRAGLNPYLVEMTNIRNLDTWVHNDRKVATEKAKD
    MIKMAVAKVHHMVPLQTIKLPVIKRALVIGCGPAGLAAATGLAGAGIETILVEKSNECGGMLRRLNRLEPEGIEARKLLD
    RMVEEAKEVGVKFMLGTTIKDVSGFTGNFHVILSNGVELDVGAIIVATGAKPYVPTEFNYGKDPRVLTTLDLENGKTVEG
    KNVAIINCVGSRTSGRGCSRYCCAVGLSKAIELKSQGKNVVLIYRDIMGVNPEVEDLYKKARDAGVLFIRIPRKAELTEA
    IRMDTNKLIVHDVELGDDVEVPFDNIILNIGLVPSEDTDETSKILRLSKDQEGFLMEAHPKLGPVDTMTPGIFIAGAARG
    PKNVAEAIAEGYAAASRALMMLAQGYVTKEPFIPKFDWSKCTKCGLCIKACPYGAIRGVPGKWIEHIPAACQGCGACVAE
    CPQDAITLDAMSDDVILAQVEAALAEEPEKKVIMFTCAY
    CSYWAADNAGIFKMQYPPYARIIRLQCSSRLAWKHVKRAFE
    LGAAGVFVTG
    CRLGDCHYITANYNTVRRFENWKKRLKNIGVRDERFQLRLFGAPDVVDLVEAMKEAERVVKSVTKEEIEM
    TKQRIKQLR

    >gi|307596432|ref|YP_003902749.1| Thioredoxin-disulfide reductase [Vulcanisaeta distributa DSM 14429]
    MDGDIDVYDVIIIGAGIAGLSAALYAARQGLRTLVISKDIGGQLSLTDEVQNYPGFISIKGLDLVRRVENQARIFGAEIV
    FDEVVKLDKVDGGDFVIRTASGDEYRSIAVILAFGKTPRDLGVPGEQELKGKGVSY
    CTICDAALYRGQDVALVSWGEPAY
    EAAEILMNVVNRFYWVFPGDKPVNDDEFMNLMLNSGKAVLMPRHDVVEIKGKGRVESVVVRDRVTGRTLEIPVKAVFIEI
    GYVAKTDFVRNLVKLNEKGEIVIDEYGRTGTEGLFAGGDVCVSPYKQAVIAAAQGVIAALSAYSYVMARKGKEVKLASDW
    RKLNIPGEKRESRTSLKISF

    >gi|307596477|ref|YP_003902794.1| thioredoxin [Vulcanisaeta distributa DSM 14429]
    MAASNMNSNMGDKEDEELSKLLEKKARELAKAVGNEPVELSGDNFDDFIRSKRVVVVDFWAPWCAPCFLLEPILKALAKE
    MPCVGFGRLNTQEWPDVAAKYDVMSLPTVIIFKDGEPADFVIGAVPKKIIADKIRRVLNEN

    >gi|307596629|ref|YP_003902946.1| methylated-DNA/protein-cysteinemethyltransferase [Vulcanisaeta distributa DSM 14429]
    MRCITLLLKDVGALEVCIYGDKIREVKVRVGVDGIRESTVGHVSEVLLKYIMGLVEPREIIKYLELSPGLLGLAQVAMLS
    IPRGRVATYAQLAKLLNTSPRAVGKLASANRLPVIVP
    CHRVIKSDGSLGGYSAGDVNVKFKLLEMEGVKVVNGKVPRQYI
    VDDATLTKNFRELLNYASSNMLI