uncultured methanogenic archaeon RC-I

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|147918688|ref|YP_687589.1| 1-cysteine peroxiredoxin [uncultured methanogenic archaeon RC-I]
    MISGEQLTGGDQSGRITIGMIAPDFEAITTHGKIKLSDYKGSWVILFSHPADFTPVCTTEFVEFSKKYEEFKKRGVKLIG
    LSVDGLNSHIAWVRDIKEHMGVDVPFPIIADLDTKISRLYGMIHPPVSHIMPVRSVFIIDPKMVVKMIIFYPSGVGRNID
    ELLRTIDALQVVDRHRVDTPANWQPGEPVLIEPPHTQHGAEDRLKEGYECNTWYLCMKKI

    >gi|147918800|ref|YP_687475.1| ThiF/MoeB sulfur transfer protein [uncultured methanogenic archaeon RC-I]
    MQPLALTDYDRRRYNRQMLIRGFGEAGQEKLRKARVFIAGCGGLGSPIATYMAVAGFGTLVIADMDIVDLSNLNRQILHW
    DKNVGEDKVKSGYEKLAQINPSINIEPFNGRIDENNVIELTKGCDLIMDAMDNFETRYLLNRASLHHNIPLIHGSVWGME
    GRITTLIPGKTP
    CLECIFPKAPPKEVFPVLGATPGVIGTLQVTEAVKVILGIGEPLAGRLLVYDGEYMEFHELKIERNPA
    CAACGKP

    >gi|147918809|ref|YP_687466.1| rhodanese-like protein [uncultured methanogenic archaeon RC-I]
    MQELQVRRMSIEELKKRMKLEKPFILADARDIDSYDSSHIPGAIPIPVDEVDQLAEGYDRDMDIITYCSSYECTASTAAA
    KAFLKKGFRNVWDYKGGLQEWQEQGNPLESNK

    >gi|147918901|ref|YP_687373.1| NADPH:thioredoxin reductase (TrxR) [uncultured methanogenic archaeon RC-I]
    MMIMTDTIYDVAVIGAGPAGMTAALYCGRANMSTILFGNIFDSQLAKAGSVENYPGFDSIQGIELVEKFHSQLGRYNVMQ
    VPALISRVTHEGDTFTLVTENGEFKTNSIILATGSRYRQLNIPGEKEFSYKGVSY
    CAVCDGSFYKGKTVALLGHGDQAAK
    SAIYLAGLCREVIILSPKPERESVTYAEQLDAMPNIQIVLSSKVLAIEGDQYVERLRYTVKNGPEQVLKVDGVFIEGGTP
    NSVLAKEIGLDVDEKGNVAVDRPDMHTKIDGVFAAGDVTGGIHQISKAVGEGACAAVSAALYIKKKKSKK

    >gi|147918922|ref|YP_687352.1| glutaredoxin-like protein [uncultured methanogenic archaeon RC-I]
    MVKISMYTLSTCPFCRKTKKYFRDRGIQFDYIDYDTADEKEQERIAADMMKHTDHIAFPFVRIGDTVVIGFNPDRYELLL
    KSEKSPATAS

    >gi|147918951|ref|YP_687323.1| heterodisulfide reductase, subunit A [uncultured methanogenic archaeon RC-I]
    MANGKENRVGVFICHCGTNIAGTVNVKAIAEYAKTLPGVVIANDYPYMCSTPGQEKIKAAVKDHKLDAIVVAACSPRLHE
    PTFRKATELAGLNPFVFEMANIREQSSWIHMKEPERATEKAKDIVRMAVAKARLLEPLQTKSVPCEKTAMVIGAGIGGIE
    AAMKLADSGILTYLIEKEPTIGGYMSRLDKTFPTLDCSQ
    CILSPKMAEAGRHPNIKLLSYSEVDNVEGFIGNFKVTVRRK
    ARGVIEDACNGCGDCATVCPVTRPNEFDVGMGPRKAIYICHPQVVPLKYTVDFDSCVKCELCVKKCGDKKAIDLEMKDTF
    VELKIGSIIVATGFDLYEIEKKEEWGYGVYDNVITGIHFERLINAAGPTGGKLIRPSDGQKPHNVGFVLCAGSRDQDSNK
    YCSRVCCMYSLKHAHQIMEKMPGVTPYLFYMDIRSFGKAYEEFYYRISDEGAKFIRGRVAKIQELPNKNLLVQAEDTLLG
    TPINIELEMVVLASAIVPKKTTEALRNKLLVSRSSDLFLLEAHPKLNPFSTSTDGIFLAGCCQGPKDIPDTVAQAAGAAA
    AAAVPINQGKVTLEPIAAKVNEEICAGCGVCERQCPYKAITMLNLEGGVRKANVNDAMCKGCGTCGGSCPGGAIKMQHFT
    TPQLIAQIDALLLGGEQ

    >gi|147918954|ref|YP_685326.1| tungsten formylmethanofuran dehydrogenase, subunit F [uncultured methanogenic archaeon RC-I]
    MFPSYSKKTENNKQVIEQRLLTQKLNLAVDLDRCTGCGVCIDACPEEAITEGPIGAVSRGKAKVSKVDVDPKKCSFCGVC
    NILCPFNAIKLSVDGVEKLPILEQQGFPVLEKKAKIDDEKCSR
    CVLCEEVCPRDAIRRDVAKVDQGHKAASTMKYAIDYK
    LDDAKCTKCGICAEACDAFKIEYKEPTPLTVKRIGEVKFDEKKCDACKVCVEICPEDAISIERKIIEEPKLSGKVAIDTN
    ECVT
    CTWCQVICPKDAAKVEKVFEGELTINTANCPAGCSTCVDVCPCNALYLPVVEEAGHKPGKLAYNKDFCIYCGACIN
    ACPADSTITMKRNKINVTGEKTNLYNKIEAKLFAEKTPKIKEA

    >gi|147918965|ref|YP_687309.1| methionine sulfoxide reductase A [uncultured methanogenic archaeon RC-I]
    MSGERQSSKQEKATFGAGCFWHVEDAFLKEPGVISTQSGFMGGTTENPTYEEVCTGRTGHTEVVEVTYDPDKVTYDRLLD
    VFWSIHDPTQVNRQGPDIGVQYRSVIFYHNAEQQKLAEASRERIQKASSKPIATSIEPAGKFYRAEEYHQRYFEKTGRRC
    CGV

    >gi|147918971|ref|YP_687303.1| NADPH:thioredoxin reductase (TrxR) [uncultured methanogenic archaeon RC-I]
    MTFDTVVIGAGPAGLTAALYAKRKGLTLAVIADSIGGQMSKTANIENYPGHEIIPGKQLALIMQEQIKQLGQDIVMDRVT
    GVERIGNRFRTTTATGKHFDSRTLIIATGAHWREIGVPGEKEFKNRGVSY
    CTTCDGPLFADMDVAVVGGANAAAESVLEM
    THYATKVYMIVRSTLKADQILADRIMSSPKVTVLQGYTVEKITGTDFVEAIHIRSKAGEQKTLQVGGVFVEIGQDPNTDF
    LKGLVKTNDKGEIIIDEYCRTSVQGIYACGDVTDVPQKQVIVAAGEGAKAAMDVYTYLSTHR

    >gi|147918972|ref|YP_687302.1| glutaredoxin-like protein [uncultured methanogenic archaeon RC-I]
    MKNIRIYSKPLCQDCNRAKAFLKDKGIKFEDIDIQKNKPAHEEMVQQYGVDVCPVIVIDDQVMVGFNPPKINKLLSDH

    >gi|147919055|ref|YP_687215.1| pyruvate dehydrogenase complex E3, dihydrolipoamide dehydrogenase [uncultured methanogenic archaeon RC-I]
    MVVGDIEVGTDVLVIGAGPAGYTAAIRLGQMGMDVTLVGPEIGGICLNHGCIPVKGIVRTLDLVADVTAAEARGIKAHGV
    EVDLNKVQAWNAQVIRKLQAGIRSLLNASGVQLFEGTCSFTSSTTAVVRIHGSTQHIRFRKAVIATGMHYIVPEGIRPDG
    RRIIFPHAVAHLHKVPGTAVILGGGIDGATMASLLAKMGTRVTLAYKSASLVPAIDDDVLQPAMKSLADLGVQTFPQASW
    EVHSEGGEVVIRSGNETTTRTPDLILICSPTKANVQNLSLDRTKVRLTDKGFVEVDDRYRTADPSIYAIGDVLGGRRNAS
    VAFRDGLSVANIIAGKPGLPDYQAMTLTIEAGLDIASAGMGEKEAKKAGIDVTVSRSPYSANGGAATYGKQDGFIKVVAE
    KQTGRILGTQIVGPRAGDLIGEALLAIEMGARLEDVALTLHPHPELNEIFADACARAAGLSANVVKK

    >gi|147919058|ref|YP_687212.1| rhodanese-like protein [uncultured methanogenic archaeon RC-I]
    MYTAHVRSISMDHLKRMMDNNEPFVLLDVRSRNDFDREHIKGARSLPLDEIEESAKNMIRPDEMVIVYCDSFVCSASTSA
    SKILTRLGYTNVRDYKGGLREWKQSGLPTESRYQ

    >gi|147919162|ref|YP_687105.1| putative metallo-beta-lactamase [uncultured methanogenic archaeon RC-I]
    MILRNLKAEGLAHNTYFIASGEEAVVIDPRREPADLRECLDLARESGAIIRYILETHRNEDFVHGSLELEKMTGATIYHG
    ASLPFKYGQPLRDGDRITFDKLSILTMETPGHTPESLTYVLYDQKYPDEPLATFTGDALFVNSTGRIDLPDENEKHVNAG
    KLYDSIHGKILPLGDHVVIYPAHGAGSVCGSGMGDRDWSTIGYEKRTNPHLQLGRDEFIEYKVGEKFVRPPYFLRMEDYN
    LNGPPLLESRRAPVPLGVQTFDRAMRQKGTEVVDIRLPQAFGGGHIPGSYSIWLGGMALFPGWLFDYETELLLVPYEDED
    AWKADRLLCRIGFDQVYGYLAGGFEPWQNAGMPIEFTGELPVDALKPLMDTSDIRLIDVREPREWQNGIVPGALLRYVGH
    LKTDLPDVPRDRPVAVM
    CSVGHRGSLGASILQKAGYGQVYNVPGGFTAWRARDYPVKPAK

    >gi|147919204|ref|YP_687061.1| glutaredoxin-like protein [uncultured methanogenic archaeon RC-I]
    MMAAKVRVFSQPTCPACNDLKEYLKKKRVEFEDMDITASKDAFNELTKVYKVRVTPLLVMGDKKLIGFDPAEVDKLLAEN
    K

    >gi|147919285|ref|YP_686979.1| glutaredoxin-like protein [uncultured methanogenic archaeon RC-I]
    MPDVKIYTQPSCGYCNQLKEYLQKHNISFEDKDITKDRTAMDELIHKYKVRATPLLVYGDKTIVGFNPDEINKVLGSEAG
    QQAEAGAK

    >gi|147919292|ref|YP_686972.1| putative 4-carboxymuconolactone decarboxylase [uncultured methanogenic archaeon RC-I]
    MPYKEFEKFEKRMGYMPQLLELIKDTNPEMFETINGLDEVILKDGAISAKNKRLIAMAITATQQCSDCVDTHARAALYLG
    AKKEEIMEAIFVAMLVGGAPSVAASRNTIRFLKGEMDPLDFAGE

    >gi|147919347|ref|YP_686917.1| putative 2-cysteine peroxiredoxin [uncultured methanogenic archaeon RC-I]
    MVYVVYAADCTYVCPKEFEEMAMYYTNFIDLGAEVFSASRDSAYVHKAWHNSTPQLQAIQYPMLANTTGHISRTFGTFNE
    TDGLLYRATFIVDPDGYVKVIEMHEGTTLQAGDSKVCEGEPVQNQPAQLGARGRDDNTGMSLRSAGKKTMLII

    >gi|147919357|ref|YP_686907.1| 2-cysteine peroxiredoxin [uncultured methanogenic archaeon RC-I]
    MIGITVTATAATPPSQAAADNRTSGTIAAPLKINDKIPDFQADAYYKGDITKINTGDYRGKWMVFVFYPADFTYVCPKEL
    EEMATYYTDFTDLGAEVFSVSRDSAYVHKAWHNSTPQLQAIQYPMLADTTGNICRTFGTLNEADGLSYRATFIVDPDGYV
    KVIEMNDNSFGRSTKELLRKLEAAKFVRDNPGKVCPPSWEPGEETITPG

    >gi|147919388|ref|YP_686873.1| glutaredoxin-like protein [uncultured methanogenic archaeon RC-I]
    MSMEHVPGRKNGEVVLYALSTCVWCGKTRELLTELGVEYSYVYVDLLSGAEFDRTVAEMARWNKSRSFPTLVINNSKVIV
    GFREDEIREVLA

    >gi|147919504|ref|YP_686314.1| putative Cd(2+)-translocating P-type ATPase [uncultured methanogenic archaeon RC-I]
    MHKPEQKNGREASPDAAPGHIEVHTFEIRGLDCADCAAKLEKYVSEMPGVARAALNFSTAVLTVEHSTPVAEIGKAISGM
    GYTYKLQGNGSPKESFLRKYRKILSTAASGIGLAAGMAASFLGLPWYVPTLCFAFAIVTGGFYIFRSALYSLKSLTPDMN
    LLMTLAVAGAILINQWEEGAAVIFLFSVGSALQSYTLDRTRNSIKSLINLAPAEASVLVDGKERKVPVRSIVPGDILIIR
    PGERIAMDGTVVDGVSSVNQAPITGESIPVEKRKGSPVYAGTMNERGTLEVEVTTLFEENTLSKIIHMVEEAQSRKAPAQ
    EFVDRFAKYYTPAVILVAAAIATIPPLFGMPFDTWFYRALVLLVIACPCALVISTPVSIVAAIGNASRHGVLIKGGTYLE
    ECSRIKAIAFDKTGTLTEGRPEVTDVVTYGCSREEAIHLAASIEDRSEHPLAAAIMRANGNNGVLKAESFEAVPGAGITA
    TVNGVRYSIGSARMFEKLGGEVQEAIAAFEAAGKTPVILGGPQGILAVFAIMDRVREESPAALKALHDARVPHLVMLTGD
    GEQAARAIARQTGVDEYYAGLLPEAKVSQITRLRQKYGHVAMVGDGVNDAPALAEASIGIAMGATGSDTAIETADIALMS
    NDLSKLSYLVKLGRRMMSVIKQNVTFSLVVKLLFIGLTLAGFSNLWMAVFADTGAAIIVILNGMRLLR

    >gi|147919783|ref|YP_686471.1| peroxiredoxin-like bacterioferritin comigratory protein [uncultured methanogenic archaeon RC-I]
    MRKAVDVNSNAPEFAARDVRGTEFNIATFRGRNNLVIFFYRNSRCQTCREELKNLADYYGYISQQDGEVVAISTDNLDEA
    KNLAVDLKLPFRVISDPEHRIADLYGVFDTTTDTAYPALFLIDKNGVVRYRKIIEGLNDLVPGSDVANRLRDMGPGMGSH
    GGFNPRPSP

    >gi|147919932|ref|YP_686315.1| hypothetical protein RCIX1788 [uncultured methanogenic archaeon RC-I]
    MEEKKVIMQLENLSCPDCAMKIAMVLRNSKGVSNAEVLYTSSKVKVVYDPEVTKVENIVKLIESIGYGVKDIKQ

    >gi|147920032|ref|YP_686211.1| glutaredoxin-like protein [uncultured methanogenic archaeon RC-I]
    MKLQVYGTGCAKCSMLEKAAKDAVKELGVSAEVVKVSDIDEIVEAGILATPGLAVDGEVKSMGRVPSGDEIKKWIKAKM

    >gi|147920132|ref|YP_686104.1| Cu(2+)-binding/translocating P-type ATPase [uncultured methanogenic archaeon RC-I]
    MRKTELKITGMTCASCVARVEKAIQETKGVESATVNLATEKATFVYDPAHITIDDIVRSIREAGYGVEEEKVTLPVRGMT
    CASCVKRVEDALKSSEGVADAAVNLATEQATIRYFPSIVTVNDIRKIVRDAGYEIPEAPSPEEYVDRERASRGREMRDLV
    VKFAISGAVAAIIMVLMFFGSYIPGLSSLSMEQVNWIGLILATPVQFWIGWRFYKGAFAALRHGTADMNVLIAVGTSAAY
    IYSVAATLWPHLLMMGGAMPATYFDTSVTIIALILLGRLLEARAKGQTSEAIRRLRGLQAKTARVERDGKTLDIPVEDVQ
    VGDIVVVRPGEKIPVDGVVVDGYSAVDESMVTGESIPVSKKESDNVIGATINKTGSFKFKATKVGRDTVLSQIIRMVEQA
    QGSKAPIQRLADQVAAVFVPIVIAIAILTFLAWYFLGPQPAFLMALLNFISVLIIACPCAMGLATPTAIMVGTGKGAEHG
    ILIKGGESLESAYKINSIVLDKTGTITRGEPELVAVVPQPGFTEQDLLRLAASAEQGSEHPLGEAIVRGATERGIGLTGP
    SKFDSLTGRGIVAEVDNALVFVGNARLMEDEDIDLSGMKPDFDRLSAEGKTPMYVAIGEKPAGVIAVADTIKEGSVEAIA
    GLKQMGIEPIMMTGDNRRTAEAIAKQAGITNVLAEVLPQDKAGEVKKLQAQGKTVAMVGDGINDAPALAQADAGIAIGTG
    TDVAIESSDITLMSGDLRGVLTAIKLSRATIKTIRMNLFWAFIYNIIGIPIAAGILIPWFGIQLDPIIAAAAMAFSSVSV
    VSNSLLLNRFKP

    >gi|147920134|ref|YP_686102.1| hypothetical protein RCIX1513 [uncultured methanogenic archaeon RC-I]
    MVFLQKAYSRFLSRLPISNIMNRLGEADSSYLRRAADEPIDWYPWGDEAFDRAKAEDKPVLLSIGAVWCHWCHVMARETW
    HDRSTAAIINERFIPVKVDRDDRPDIDRTYQEAVQALTGNGGWPLTVFLTPDKQPFYGGTYFPDRPRHGLPAFRDVLTAI
    ADLYTNDRGSVERIVNDLTQRFPFVSPLRQPVDPAYLEEVVKQMRSAHDTVSGGFGSSPKFPYSEALLFLLQYYESTGDR
    TAWEIVDNTLSHMAAGGVYDQVGGGFHRYSVDAGWKVPHFEKMLNDNALLLNAYLGAYQLSGNQYYRQVASEIVEFVFRD
    LRREPAGFASSIDADVHHEEGAYFVWEEQEIRDVLGDRADAFIKAYNVTRGGNFEPTKNVLYPTGETDKAQFAKEKKALL
    QARDKREKPYVDMSIHTSWTALMITSLARAYSVLGERRCLDYAVESASFIMDHMYRDGTLYRTYTDKPVYSGYLEDYSCM
    IEALLELYVVTQEAGWLDQAEKLLDDCEAKFFDREHGGYFFVQAEDRTPMMQDKPVTDFSVPGSNPQMAMNLIKLSNYRD
    KLEYMDRALALVEGFFDLCRQYPLGHGTYFAALDYYANPPEMVAIVGPEKEGRELVDLVNGRLIKKIVMLDHGQYRQRPA
    VFEGRKAENGRPTAYFCKDRKCILPLTDREDILEMLKRPRFGGDTNSGSS

    >gi|147920236|ref|YP_685997.1| putative 1-cysteine peroxiredoxin [uncultured methanogenic archaeon RC-I]
    MENVDSSAVRKDPSEKVAKPLAPGARAPDFALRAGHDQIVKLSDYKGRPLVLVFYPADFSPVCTDELALFNEVLPEFERY
    GASIVGISVDGIWSHQAFAKSRNLRFPLLSDFEPKGEVSRAYGVYRETDGMSERALFLIDGDGIIRWSYISPLKVNPGAD
    GVLKALEDLKAGGERAAATV

    >gi|147920372|ref|YP_685855.1| 6-O-methylguanine-DNA methyltransferase [uncultured methanogenic archaeon RC-I]
    MVADWIYAEPIGLYVIVDVDVDGKTVETLEMTRKKPAFKAAGTPVAKALEAYFRTGSDEVLRGFDFDRTGLTPFRIKIME
    ALRRVPAGETVTYGELAAAAGSPGAARAVGNVMARNPVPIIVP
    CHRVVATNGLGGFTGGLDVKRKLLRLEGAEY

    >gi|147920432|ref|YP_685777.1| 2-cysteine peroxiredoxin [uncultured methanogenic archaeon RC-I]
    MLRINDRVPDFEVDAFADNDIKKIKFSDYRGKWMVLIFYPADFTFVCPTELEEMADLYPKFKELNAEVFSVSRDTAFVHK
    AWHDNSPAIKKIRYPMLADPTGKLCREFGTYIEEEGVSLRASFIIDPDGYLKAIEMHDNSFGRSAKELLRKLEAAKFVHD
    HKGRVCPASWQPGEETLEPTIDMVGKI

    >gi|147920483|ref|YP_685724.1| thioredoxin [uncultured methanogenic archaeon RC-I]
    MAETSQLVMDTSDASFDSAIKSSRVVVVDCWAPWCGPCRILAPTIESLARDYDGRVKFYKLNTDENPQVASQFRIRSIPT
    IFIFTDGKLADTIIGAVPRQYIEGKLEPLLK

    >gi|147920484|ref|YP_685723.1| thioredoxin [uncultured methanogenic archaeon RC-I]
    MAETSKFVTDLTDATFDDAVKSSSLAVIDCWAPWCGPCRMLAPTIETLAQEYEGKVKFYKLNTDESTRVVQQFKIFSIPT
    LLIFAKGKQVDTIVGAVPRQYIESRLQPLLENQ

    >gi|147920816|ref|YP_685378.1| HesB family protein [uncultured methanogenic archaeon RC-I]
    MVTVTDKAASELKTLLANENKADHMIRIYFAGAGCSGPQYAPALDMNKTEDDVTTNSNGINLVYSKDLAEELKEFQLDFI
    ETPYGSGFIVRNPNQTCGSGCSGCH

    >gi|147920864|ref|YP_685329.1| heterodisulfide reductase, subunit A [uncultured methanogenic archaeon RC-I]
    MANGKENRVGVFICHCGTNIAGTVNVKAIAEYAKTLPGVVIADDYPYMCSTPGQEKIKTAVKEHQLDAIVVAACTPRLHE
    PTFRKATELAGLNPFVFEMANIREQSSWIHMKEPERATEKAKDIVRMAIAKARLLEPLEQKSVPCEKTAMVIGAGVGGIE
    AAMKLADSGIVTYVVEKEPTIGGYMSKLDKTFPTLDCSQ
    CILSPKMAEVGRHPNIRLLTYAEVANVDGYIGNFNVTVKKK
    ARGVIEDACNGCGDCATVCPVSRPNEFDIGLGPRKAIYICHPQVVPLKYTVDFDSCVKCELCVKKCGDKKAINLDMKDEF
    VEIKVGSIIVATGFDLYEIEKKEEWGYGVYDNVITGIHFERLINAAGPTGGKLIRPSDGQKPHNVGFVLCAGSRDKDAQQ
    YCSRVCCMYSLKHAHQIMEKMPGVTPYLFYMDIRSFGKAYEEFYYRISDEGAKFIRGRVAKIQELPNKNLLVQAEDTLLG
    TPINIELEMVVLASAIVPKKSTEELRNKLIISRSSDQFLLEAHPKLNPFSTSTDGIFLAGCCQGPKDIPDTVAQAAGAAA
    AAAVPINQGKVMLEPIAGKVDDALCSGCGVCVGLCPYKAITMVDIEDGKRKANLNDAMCKGCGTCGGACPAKAIRMQHFT
    NPQIRAQIAALFTPAGGV

    >gi|147920867|ref|YP_687320.1| tungsten formylmethanofuran dehydrogenase, subunit F [uncultured methanogenic archaeon RC-I]
    MFPSYSKKTENNKQVIEQRLLTQKLNLAVDLDRCTGCGVCIDACPEEAITEGPIGAVSRGKAKVSKVDVDPKKCSFCGVC
    NILCPFNAIKLSVDGVEKLPILEQQGFPVLEKKAKIDDEKCSR
    CVLCEEVCPRDAIRRDVAKVDQGHKAASTMKYAIDYK
    LDDAKCTKCGICAEACDAFKIEYKEPTPLTVKRIGEVKFDEKKCDACKVCVEICPEDAISIERKIIEEPKLSGKVAIDTN
    ECVT
    CTWCQVICPKDAAKVEKVFEGELTINTANCPAGCSTCVDVCPCNALYLPVVEEAGHKPGKLAYNKDFCIYCGACIN
    ACPADSTITMKRNKINVTGEKTNLYNKIEAKLFAEKTPKIKEA

    >gi|147920938|ref|YP_685254.1| putative NADH dehydrogenase [uncultured methanogenic archaeon RC-I]
    MNGRRIVFVGAGGAGLTAAFTLARRAPDAQITVFSKDPVVAYSQCGMPFVLDRKILDFNKLVIYQPPVFKDLGLDVRTST
    AIEEIDLDGRAVTTEKGERVEYDRLVIATGSRPFVPPVPGVHLPGVHTLLTLEDGKALYERLKDALNVVIIGGGPIGLET
    APAFLDAGAKLTIIERVPQLMPSALDPEMAAIVQAHLEQKGARVITGRGVDSINGTARVESVTCAGEVIPADLVLLSAGI
    RPNTDLAKQASIDLGVTGGIVVDEYFRVRRNGKVLDDVLAAGDCAEVTGLITGKPVIYAVGSVANRQAKYVADNLLGKKT
    PYPPVLCPAVCVIGDLHVGNVGLTTHACEQAGITPLTFSARGATRARYYPGGKTVDIKLLSDGDRLVGGQIIGEEGVGGR
    INVLSLAIGKGMSPADLAGAETCYAPPVSPLIDPLTYAAEMLALKVARAKKSQ

    >gi|147921023|ref|YP_685167.1| putative peroxiredoxin-like bacterioferritin comigratory protein [uncultured methanogenic archaeon RC-I]
    MDYRIEEGEMAPDFTLGRTDGKKVRLYDCKNKKAVVLFFFNHEDERCLTRLSAIGKDYQQFRDAGAVIFPISIMTAEEGS
    KIKDQLGLPFPLLCDSDHSVAHIYRVAQCSEVQSHVCFEIITHIDDPRILIVDPSGIIRHIHRLNLPGGSPGNEVLIREC
    REAFR

    >gi|147921057|ref|YP_685133.1| thioredoxin-like protein [uncultured methanogenic archaeon RC-I]
    MRLKALLYLLITGILSISLLASGCTLPRATPAPTGTPVPGSPADAGIPEISDMSPVDTALESRPVFIEFGAPWCFWCELE
    KPVLEDLSAEYPDIAFYSANADESPRLADDFYVQGIPAMYLIVKKNADGSYVYIDPAGKTSSDRAKSMIRGYRTYDQLKP
    LMEAAEAAK

    >gi|147921226|ref|YP_684961.1| rhodanese-like protein [uncultured methanogenic archaeon RC-I]
    MALRDDICSAMESYMMNAPSDWNTVTVEELKQELASNPKLFLLDVRERDEFASGHIPGAVNISVREIPQRVKELPREKDM
    KIVAY
    CASGIRSAYATMFLRVYGYSDVRSLVHGIREWVATGNQIVA

    >gi|147921275|ref|YP_684911.1| dihydrolipoamide dehydrogenase [uncultured methanogenic archaeon RC-I]
    METFDLIVIGSGAGDQIVSYALSDGSKVALADRGPTGGTCLNTGCIPSKMLIYPADVIRAAQEASAIGVATTIKPDFGQI
    MERMRNFVDGERQGMEEGLRKAKNLAFYQGVAEFTGPHTLKVGSHEITAPKIVIATGARVAIPPIPGLKETGYLDNVSLL
    QLREMPKSLIIIGGGYIGCEYAHFFSAMGADVTIVSRPPVLLNDEDPEVSDTVTKVMSRYVHVQTGFEADKVGREGDRKV
    VYAKSKKDGTTASFEADEILVALGRRSNADLLKPEKAGVETDAKGWIKVNKYLETSVPGIWAIGDAIGRYMFRHTANYHA
    EVVYTNMFSEHKMEVDEHAVPHAVFTHPQVGHVGMTEADAKAAGIKVLVGRAKYIQTAKGIAMHNHDGFVKVVVTADNKK
    ILGCSVVGPDAAVLVQQVAYMMNCGRQDLGPLYTTQVIHPALSEVVMRAFGNLQPA

    >gi|147921465|ref|YP_684720.1| putative heterodisulfide reductase, subunit A [uncultured methanogenic archaeon RC-I]
    MKRGKAGVFICHCGDNISGTVDIGAVKRAMELEGADCVEDFPYMCSIAGQALIHEKARAIGLDRIVVAACSPGVHERTFQ
    ACASEAGINPYLVDIANIREQCSWVPGENQTGRAIDIIRSSLYAVRQKQPLDKASIKVRKSVLVIGGGISGITASLALAR
    HGIKVYLAEKATTIGGNMVKIGKVFSPDRLTEECAL
    CSLAPLMGEVARNDRINIMTQSRVTDLRGHPGDFRVTIETGPVF
    IDPDKCVSCGKCSAACSVRVPDEWNAGLSSRKAVYKPFAQAVPGTYSIDPDACKRCGKCARECDARAINLNRKARKKTLR
    AGAIIVATGHREMDPSGKHELGYGQFPDVLTQTELARLLAINGPTKGRLEVPSTGKRPRRIVMVQCVGSRDEKPGSIPYC
    SKVCCMTALKHAHYVSEHFPGTEIYICYTDIRAPGTYENYYREVQKKGVKFIRGRVGEIIRAGADDSDGLLVRVEDTLGS
    GTLELESDMVVLSCALEPSPGTLQAASALGIGLSPELFIREKHPKLEPATTTSRGIFVCGTAQGAKDITESILQARAAAS
    KASELVSARSLAVEPKFAVVDPERCTRCGICLKLCPYGAPYLNGKVAIDPLSCIGLGGCISRCPEHAITMPSCSDEELFA
    RIDGCLGPGADIIAFLDENIGYVAADNAGVNRIPYPEGVRIIKVPSIMRLEAKHLVYALEKGARGVFLGDGTVNSANGAI
    RANVSKRVGELRAAVAACGFRPEQITYYEAYLPHFRGLASRLSQFSASLGSHAPEGRVDQATGVSF

    >gi|147921541|ref|YP_684643.1| peptide methionine sulfoxide reductase subunit B [uncultured methanogenic archaeon RC-I]
    MTQFKKPSKEELKKKLTPLQYEVTQESGTEPPFRNEFWDDHREGIYVDIVSGEPLFSSKDKFDSSCGWPSFSRTIDEGKV
    EEKQDTSHGMIRTEVRSKEADSHLGHLFNDGPAPTGMRY
    CINSAALRFIPKEDLEKEGYGKYRKLFEK

    >gi|147921637|ref|YP_684546.1| thioredoxin-like protein [uncultured methanogenic archaeon RC-I]
    MTANRRTTVLIVSAVVFTMLLGGIAFAQQAAPAPQAMETTTPGTSGIAVKSGPVTMADIDNALASGPVFIEFESKTCTYC
    KEQRPISDALAADYQGKVTFFFADVAESRDLAKYFQVSGVPQINVIAQKADGGYTYVGKDGSTSSSIAGSKFLGLTQSDT
    LKTALDAAVRMRGQ

    >gi|147921673|ref|YP_684508.1| putative 4-carboxymuconolactone decarboxylase [uncultured methanogenic archaeon RC-I]
    MKFENTLKGIFGKEPDDAVQELLKNIEDDYGEVPFILKAMSDRPNVLLPKIIYDDAVLRNPEHLDETTVELITIGVATAL
    KCDH
    CLKMHLRVARRKGIPEEKVFETILLASALSNTAALAQAMRVFEADKEEHRDTEAFKDECPGCIVYENNHKNLNGND
    KTD

    >gi|147921707|ref|YP_684473.1| thioredoxin-like protein [uncultured methanogenic archaeon RC-I]
    MDMMEQKLNWMEKYDEVQDVARKTGKPILLFFHSHHCSGCKMMIEKTLPTRDVVLHAGHRFALGMFEISEPGNKDLVKKY
    NVEWTPTFIIADKDGSEAYRFVGYLPPKDFRAQLILGEGKVSMRNEDYDKAISCFETIDKKYPETEAAPEAAYYTGVAQY
    KKTNDAKMLKNAHIYLSRKYPESDWAKKAFAWSGL