Thermosphaera aggregans DSM 11486 uid48993

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|296242150|ref|YP_003649637.1| dihydrolipoamide dehydrogenase [Thermosphaera aggregans DSM 11486]
    MKYDVVIIGSGTGGYPGAVYLAQRGFKVAVVEEKLIGGECTNWGCVPSKALYQVAEAVRVVEKVKGQASYKWEDVVDWAK
    SIVEETREGIKYLLEASGVEVLSGKGVLKNPHQVTVSEDGSKREVEADKIILALGTDPSQLPHVKFDGEGILSNREVLFM
    REKPSSILIVGGGVIGVEMANVFSKNGVEVTIVEIMDHILPFTDKDIAQALKTYLAGNGVKVREKTSVENVEKSGGKYNV
    KLSNGENLTVDKVLIATGRTPKTKGVGLEETGISLDKKGYVIVNDECRTNVENIYATGDVIGGPQLAHKAILESVAVAKK
    IAGRESFKLDYHLVPITIFTGLEVASVGYTEKELSTMGVKYVKVKLPIYYLAAVKIKGGRNSFVKILLDEKSEKVFGIQV
    VSPNASEVISAYLPLYLGRLSFKEATSVPYPHLTVAESLRDVAEYLLGEPVHFIRK

    >gi|296242217|ref|YP_003649704.1| OsmC family protein [Thermosphaera aggregans DSM 11486]
    MRLEKMEIPKVEVTAKYTASNPNVVLKARSIVREASELPEFGGVGNDFTPLEYMLASLASCEAFMFGMFAKMLSKKMPIV
    EISVEGEFGIGEGVKSLRIKYHISGIEEETALAIINQVKTTCPIYNTLVKACEKIFEEVIVKPS

    >gi|296242236|ref|YP_003649723.1| alkyl hydroperoxide reductase large subunit [Thermosphaera aggregans DSM 11486]
    MSGLFDQETESELKNIFSKWPRNLKDILIIDEDKHEGAHSHEKPLDHCHTCEDAVVLARELTRISEGKLGFNILKKAEAM
    ELKPRYLPSFIYDTPSRNVRYYGLPSGQEFAPFIFAHEYIATKTLKLPEDVLEEVESIDMPLHIKVFVTPE
    CPYCSIVVD
    FMNQVGIVNSNIIVETIEAMENPLEADSYGVQYVPFVAINRIEDYYRYGAKPVEVIPGYLPPEEAVKVLSRAVRKLRRS

    >gi|296242297|ref|YP_003649784.1| 1-Cys peroxiredoxin [Thermosphaera aggregans DSM 11486]
    MPGQIPLIGEKFPEMEVVTTHGKKKLPDDYKGKYLVLFSHPADFTPVCTTEFVGFAKRYEDFKRLNAELLGHSVDGVFAH
    IKWVEWIKEKLGVEIPFPIIADPAGEVGRKLGFLHAQSTTHTVRAVMIVDTEGVIRAILYYPQEAGRNIDEILRLVKALQ
    LNDKYKRAVPHLWPNNELIKDSLIVPPPTTVQAAKERLAAYKCYDWWFCYEEGKVPGEEVVEVRKWLERAASKP

    >gi|296242344|ref|YP_003649831.1| methylated-DNA/protein-cysteinemethyltransferase [Thermosphaera aggregans DSM 11486]
    MLVVTVDHETLELRPARFDDICEAVLILVSLIPIGKVSSYSDIGRLLGAHPRLVAQCLMRNKNPMVIPCHRVVRKNGRLG
    GYSFGGVKIKAKILSIEGALGDSDKFGVPKNAFFRLDELLGSAR

    >gi|296242523|ref|YP_003650010.1| thioredoxin/glutaredoxin [Thermosphaera aggregans DSM 11486]
    MSIVELVVHPTCFSSYRLLKTLGEKGFLNRLRILVADKPSIGFEKKAWSVPWLLVNGEPAAADPLEPWEVEAVLEGRGLQ
    PPADPAESFMTSVMHSSYASSLVVLWGSLEPVLDKGFAKAAYRAPLTGVDVDKALEEVRGRMRELYNEWVDKLRRTLAVA
    FARELYWSSNRRLTTDDLVSASRPEVIGAWLLAKASIGRVGLPSNPLGAGMANAEEISSFISKTGKGILNKVENEANTLF
    NDKEYWEIVNHLKNGV

    >gi|296242969|ref|YP_003650456.1| heavy metal translocating P-type ATPase [Thermosphaera aggregans DSM 11486]
    MRKARFKIIGIDCPSCVYAIERRLRSLGCISGFKVEVSTGEAEVEYDEEKCFLKNIYEAVRDAGYDVYKEKVYFDLKGFS
    GEEAASVESKIRGLHGVFDIRISPTGVATVIFNPLETTLDDVSKKLAAYGAKPLSATAEKSASLGEKTLLYRRMASFTIG
    LLAVTLSMYSMLAGGVHDHGIISEPLLLALAGTAILLNYDIVARGLKSLLMMIPVMDSLIAVSVISTFTAGVASTIGLMR
    LHGGLHASSFFEASAGVIGFVGLGKYLEERLRRRTFKSLEDLASLLRGNAKVVVGDSVVEKPVSQLIPGEIVEVRAGEII
    PVDGVVVEGSGYVDESSFTGEPVPRAKKADNRDPVLAGSVLNTGYLRIRATRVGGDLLIAQVIETVREAESVKPRLARIA
    DRIVGYFTWIVLGLAIATFSYWSLIAGNPQMAVVFMAAVLTVACPCALGIATPLVVSIAVLKASKKGVLIRAGDVFEKII
    GSDTIILDKTGTITVGKPVVVATHLLNNAGKEHVLRMACSVESRSEHPLSRAIVEKCVSEDVKFPEPEEYVSIPGEGVYG
    LVEGVSVAVGNVELGERLGASISENALRLVEEAGRRGNTPVIVFINNEAKTVLEIGDVLKEEASSVVRALKDYGFKIGLA
    SGDVEASVKYYKDTLGLDFAYWGLKPRDKADLVREMQKNGSRVVFVGDGLNDAPALAVADVGVAMGSGADVSKEAGDIVV
    LNNSLKTLPFLLDFSRLVRKKIIQNIAWAFAYNIVLIPIAMGVLYWSHRLFITPELAATAMIMSDISVLANALSILRS

    >gi|296243023|ref|YP_003650510.1| thioredoxin reductase [Thermosphaera aggregans DSM 11486]
    MSTKFRITGLSAVRTAPAIEDRYETIVVGGGPAGLTAALYSARYGHKTLLVTKLLGGNITEAPLVDDYIGIPDISGNDLA
    DKFVKHVKKYNVPIIIDEVVDVVRKPEENLWCIRLRDMKKEVCAYSIILAVGSEKKKLGVPGERELVGKGVSY
    CATCDGP
    LFKGKVVAVVGGGNAALTSAIYLAKIASKVYLIHRRDEFRAFNVYVEAAKNSPNITFLLNSVITEIIGRDRVEAVKVLNK
    AEGRESIINVDGVFVEIGLQPPVEFFKKIGLELDETGRVRVNVDRSTNLPGIFVAGDAAGGPFKYRFEQIITAAADGAIA
    ADAACKYVCALRHAGGSMPK

    >gi|296243091|ref|YP_003650578.1| glutaredoxin 2 [Thermosphaera aggregans DSM 11486]
    MPEVVIEVLGPEPPCPRCSAALYIVNKVVNRLGVRGSVEVVKKDINSDDVLDKYGVLISPAIAVNGEVKFQGRVPSEKEL
    EKLLRSFLSRDVQG