Thermoproteus neutrophilus V24Sta uid58421

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|171184575|ref|YP_001793494.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Thermoproteus neutrophilus V24Sta]
    MEFPDLELTAHTGERVSPARAPKAVVYFFPKAFTQGCTRETVRFNELYPRFRERGYEVYGVSTDGVETLRRFAERYKVQF
    KLLSDEGGRLASQLGILRPTGTAERVTYIVVGGRVVHVLRGLKSADEHADRALELT

    >gi|171184670|ref|YP_001793589.1| UBA/THIF-type NAD/FAD binding protein [Thermoproteus neutrophilus V24Sta]
    MSPVKILDRYSRQIAVIGEEGQRKVRSTAVAVFGVGGLGTLVARYVVGGGFRKVFLVDHDVVSPPDIHRQILYTSREVGR
    PKAEVAAAVLRDVNPEVEVVPIAEAVSPQLAEEVLGEADIAVDALDNWASRHVVNAASVKRGRPLVHGAVQEWYGHVTTV
    VPGATPCLEDIFGRFKSLPT
    CATGFCPVLGPAVGVIASLMALEVFNTALGKPALAGKLLVVDLKHMAFDAIELQRNPACP
    VCGVSRRF

    >gi|171184826|ref|YP_001793745.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Thermoproteus neutrophilus V24Sta]
    MPEVKGPYLGMKIPEDLCFDTDAGRRCFRDYKGRWLLLFSHPGDFRPVCTTEFIAFAKKYDEFKKRGVELLGLSVDTVYS
    NVEWKRQIKQLWGVEIPFPIISDVPDFQVASLFNAIPPGTTVTVRALALIDPELKLVWFALYPLAVGRGVDEILRVIDAI
    QFNYKHGYLAPVDWRPGDPVIVPPPQRYEGAEKRLKETGIECKTWWFCTKKYEEVVG

    >gi|171184900|ref|YP_001793819.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Thermoproteus neutrophilus V24Sta]
    MKTVVVVGGGTAGATAASRAKRLCPQCRVVLVEASRYITHAPCAIPYAIGGFAQGEIWLYSEEEFESERGVEVYTETRAV
    DVAGDKVFLEGKLGGSLRFDVLVVAVGARPAVPKVEGVELEGVLPVRGVEVVDKAKRLLQGARDVAVVGAGYIGVEMADV
    LAQMGKRVVLIDGSPRPLAKSLDPDMSAVVARYMGERVELRLGERLVRIGGEGGRARYVETDGGRYPADVVFLATGVRPN
    VDLALKAGARLGQTGAVEVNEYMETAAPAVYAAGDVAEARHAVTGEPVWIPLAIYANKMGCVAGTNAGLGRRAISFPPVA
    GASVTKFLDMYIGSTGLTEEEARRRGIYGNSISISATDKARYMKGAVDVTLKAVVDREGRLVGMQIVGRTPSVGGLVDLA
    TQFLGRPVEDMFKAEYSYMPFTASPWHPFTIIARLYLRERLR

    >gi|171185189|ref|YP_001794108.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Thermoproteus neutrophilus V24Sta]
    MEADYDVIIIGAGIAGLSAALYASRQRLRTLVISRDLGGQLNMTTLIENYPAIPKISGPELAKRVEQQARSFGAEIIFDE
    VKTVEKGEGVFIVKTEGGDEYKTLAVILAFGKTPKELGVPGEAKFKNKGVSY
    CTICDAPFFKGQDIALVSWGDLAREPVT
    ILSSVSNKFYWIYPSEKPIHDDEFIEQARRLGKAVFMPNSEVVEIKGDTKVRSIVVRNRKTGETQELPVAAVFVEVGYVT
    KSDFVKHLVDLNERGEIIADWEGRTKTPGVFAAGDIVAYPYKQAVISAAMGVAAALSATAYVMKIKGRPLHSLVDWRAEK
    K

    >gi|171185716|ref|YP_001794635.1| peroxiredoxin [Thermoproteus neutrophilus V24Sta]
    MPEVKGPYLGMKIPEDLCFNTDAGRKCFRDYKGKWLLLFSHPGDFTPVCTTEFIAFAKKYDEFKKRGVELLGLSVDTDIS
    HIEWKRQIKQLWGVEIPFPIIADVPDFQVSSLFNAIPPGTTVTVRALALIDPELKLAWFALYPIANGRNIDEILRIIDAI
    QFSYKHGYATPADWRPGDPVIVPPPHSYEEAEKRLKEPGIECKTWWFCTKKL

    >gi|171185744|ref|YP_001794663.1| methylated-DNA--protein-cysteine methyltransferase [Thermoproteus neutrophilus V24Sta]
    MICARYGPAAVGWDGVRTYVNPPRCSRWVELRDIVEELPLDRIDRRLLYLLGIPRGYVTTYKLYAEALGTSPRHVGWLMA
    ENPLPVLLP
    CHRVVKSDMTLGGYAGGVELKRRLLEYEGALCGGKPCRIAKPRPVADIKNAILQSLGVEPT

    >gi|171185958|ref|YP_001794877.1| glutaredoxin-like domain-containing protein [Thermoproteus neutrophilus V24Sta]
    MHVGCVDMAVPIGGPEEVPHIEVDEETKEIIKEMLSQMENVVEVNFFTSANCGGRETNWCVPTEELIDLLAQLAPPGKLK
    VNKYSYDKDQEVFKKFGIEPQRVPAVIFGDGFVRYLGSPIGEEVRAFIETVVRLSTGKTGLRQKTRSELAALAQNAPKRV
    NVITVVTPS
    CPYCPYAVLLANMFAYESKGKVVSVVVEAHENPDIADMYGVTGVPTVILQAEDAAVGDVEFVGVPPEHELL
    ARVKNHMGLS

    >gi|171185961|ref|YP_001794880.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Thermoproteus neutrophilus V24Sta]
    MVRVVIVGGGAAGASAAARARRLDPNAEVVLIERGSMITHAPCGMPYAIGGIVKSHEDLMTYRPEEFEKERNIRVLTRAA
    VLDVDVDKRMVAVQRGSSVEKIQWDKLVIATGAKPLVPKIPGVDLKGVLTMRHPDEVPEIKGHLEKAKTVAVVGGGYIGV
    EMAEVLLEMGKKVLLFEMADQLLPATLDPDTAAIVAEEMKSRGVELHLGEKVVELAGTGHVSKVVTEKGEYNVDEVILAT
    GVKPDVDLALKAGAKLGETGAVYVNEYMETTVPDVYAAGDVVEKTHRLTGRRVWIPLAPTANKEGQVAGGNAVRGRVLKF
    PGVVGTAVTKFYNLYIARTGLSEREASQLGLKTQSALIKARTKAHYMPGAETVHMKLIAEESTGRILGAQVLGRSQIVAA
    YVDIVAVAAERGYTVSDMFFADIGYMPDTAPVWHPLIVAARVLSRGKL

    >gi|171185962|ref|YP_001794881.1| thioredoxin domain-containing protein [Thermoproteus neutrophilus V24Sta]
    MDDVERLLWKKAVELTSRKTPQCCNVSYAPGQVLYGVDQLRNAVASCKTAFVMFFGKMCPYCQMFDPIFRQVGERYRAYA
    NFVKADVEVFFDLAARLGVMGTPTTVAFVEGRPLDAVSGFLTAPQFKAFVESVLSRAGCR

    >gi|171186056|ref|YP_001794975.1| thiol:disulphide interchange protein, putative [Thermoproteus neutrophilus V24Sta]
    MSPPVKCFYGLFVSIAVLFRRPRPRLTPVTRGDAVRRILELASVKVGSGERALVVFFDLRCPFCAKLFRETEEVLLEMAQ
    RGLIIYAMCDYVVHREAEHLHRALRCISEGERLGFIREVFSGKRVETGSCPEGNLRECEKVAEEVGVYGTPTLLFYHLGK
    DRGYVHFGYMSPSEVMETLSSL

    >gi|171186057|ref|YP_001794976.1| hypothetical protein Tneu_1607 [Thermoproteus neutrophilus V24Sta]
    MYVGLMIKVVIHHTCKSSYVLYKALRGTPGIAFEMVGTRYLPYLKSYILSVPAVFNDGRLILLDPVEPNDVLALRDGKTE
    KDLDLDEAAENFMRGVMASQAILAAVMLYKSLKPALEPELVAVLSRARYHRQEDKTDQITRRLAEREEELIRENWERLVK
    ILTFGLVREMYWLGADVDNVEPIHVKMWLLAKATVGRLGLPYPKPAVPEDVAAAVYTTLKESGRRYLDKVAEEQTTILTD
    ADFMSLAKV