Desulfurococcus kamchatkensis 1221n uid59133

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|218883507|ref|YP_002427889.1| methylated-DNA--protein-cysteine methyltransferase [Desulfurococcus kamchatkensis 1221n]
    MIIPPGKTTSYSSIARLLKIHPRVVAYCLSINKRPVIIPCHRVVYSDGGIGGFSLGGSHVKKKLLSLEGVEFLDGHVKED
    YIMDLESSILSKTS

    >gi|218883565|ref|YP_002427947.1| alkylhydroperoxidase like protein, AhpD family [Desulfurococcus kamchatkensis 1221n]
    MVDYMSYKAELEKIVSILNELSSRTPELQEFLKYVHEAESAKTLDTKTKELISLGIAIAVRCEPCIIWHTNAVVNAGATM
    DEILDVIKVAVCMGGGPALMYALKAYNVAKEFLAGKK

    >gi|218883607|ref|YP_002427989.1| dihydrolipoamide dehydrogenase [Desulfurococcus kamchatkensis 1221n]
    MRYDTVVVGSGTGGYPGAIYLAQKGLKVAVVEEHLIGGECTNYGCVPSKAFYQVAEAIRSIEKIGGEASVKWENLVEWVS
    QVVRESREGIKGLFESHGIDVIEGRAILKTQREIVISAGEEKRRIEAGKILLALGTDPSPIPGVSFDSEGIISNREALYM
    REKPGEVLIIGGGVIGVELANILSSFKVGVTVVELMDHILPTMDRDVAQALKTHLSSRGVKIYEKTTVKSMTKTGGKYLA
    ELSNGLKLEVDKVLIATGRKPRTREAGLVENNIALDQKGFIKINERQETSIPGIYASGDVVGGPLLAHKAILESISAARW
    MSGEEGFHIDYSSIPSTIFTGLEIASIGYTEKELTSRGVKYVKVRIPAYYLSAVKIKGGKQSFIKVLLDERQEKILGVHI
    VAPNASEVISAYIPLYLGKIGFGDISRIPYPHLTVSESLRDFAEYLLGNPVHLLKK

    >gi|218883752|ref|YP_002428134.1| NADH:polysulfide oxidoreductase [Desulfurococcus kamchatkensis 1221n]
    MRRYDVVVVGGGAAGFTAALTARMLYPELSVLMITRSDKIPIACTLPYAIAGNRPLEDYLMPYNYASMLGVEILVDEVVG
    VDTENRVVKTRNGVEVSFGNLIIATGSKPEAYKVEGVELQGVYVLGKDYDKLTELRKVVNHDGIRIVVVGSGLTTIELAD
    ALSGIPGLIDHVKRGVTVISRRRYILSRYFDSEFAEIAEKELVSKGVKIYTNTRIKRILGETSVKGVELDNGETVEADIV
    IIVPTWVPDTELAVKAGLDVLRQGVIVNDYMQTGKPYVYAAGDCIVKRDFLTSGMRDIKLATLACEEARRAVSAIKGVAL
    SPSRMGRIPVTVTRIGNIVMGAAGYIETHALNQGVSYIVGRAKAVNRHPVWFPGGCEVQVKLLFLQDGRLIGGQVAGACN
    EVAEITNTIAVAMQGSLRIEDLIIGLQHGSHPLLTYSPVMHPLINAAIDAYMKMKGCGCQGVSNYNITSS

    >gi|218883914|ref|YP_002428296.1| Peroxiredoxin [Desulfurococcus kamchatkensis 1221n]
    MEVVTTHGKKKLPDDYKGKYLVLFSHPADFTPVCTTEFVAFAKRYEDFKKLNAELLGLSVDSVFSHIKWIEWIQEKLGVE
    IPFPIIADPNGEVSRRLGFLHAQSATHTVRAVIIIDGNGIIRAVIYYPQETGRNIDEILRLVKALQLNDKYKRAVPAGWP
    NNELIGDGLIVPPASTIQEAKERVKQYKCFDWWLCYEEGKVPPEEVKEARSWLERAAKP

    >gi|218883966|ref|YP_002428348.1| glutaredoxin-like protein [Desulfurococcus kamchatkensis 1221n]
    MGGLFDPDTESELRKIFQAFPRELNDILVVSSSGGGHEHHEDEEEHHHHHGDCPTCDEAKVLAEEIMRISGGKIRFTILN
    PENFSGLRPRYIPAFIYDTPKRNIRYYGLPSGQEFAPFIFIHDYISNGVKLSKSVIEEIESIDTPLHVKIFVTPE
    CPYCP
    LVVDFFNQAGIVNQNIVVETIEALEHPIEADSYGVQYVPFVTITKLSDYEKYGAKPVEVIPGYLPPEENAKILVKAGNKL
    RRINS

    >gi|218884002|ref|YP_002428384.1| Thiamine biosynthesis/tRNA modification protein ThiI [Desulfurococcus kamchatkensis 1221n]
    MPTYLITVAGEIPLKSKKTRSRLYYRLIDNIRRRLARRNITLQVAKVIDAKILVETQVEALQELSRVFGVHRVSEVQVLE
    FRDLGELAKEIASRTIEHVRDRKFAVRVKRSGRHGFTSLDVAREVGALLKPYSKGVDLENPDIEVEVEVRGNKAYLYSNV
    AMGPGGLPLGSSGRALVLFSGGFDSPVAAWMIAKRGVEVDFLHYVMGSSEVSRQAFSVARKLSEEWLSSYNPRFITVDFT
    PLIAEIEERIEWSYRQVVLRALMYMVADKIATELGYNTIVTGEALSQASSQTLANLVAVESAVSPRSIILRPLIGFDKEE
    IIEYSRRIGLYDYSSRVAETCAIAPTHVVTRISSEKLKSLIERLDVRLVERMAGEYRVVDVFSASPEEAVPGYSEEIDSI
    PGDSIIIDVRSYEEYKRDALPGAIHLSMVDFNNLPRDKPVVLY
    CTTGGISLLLARELRGKGFKAYSLRGGLARYRAGLEK
    TR

    >gi|218884573|ref|YP_002428955.1| Thioredoxin reductase [Desulfurococcus kamchatkensis 1221n]
    MVVFMSSRFRITGLTTTIYKSGEKYDVIVIGGGPAGLTAALYSARYGFKTIIVTKLVGGAVSEAPLVDDYPGIPDIPGND
    LVDRFVKHVKKYNVPIVIDEVINLVKKPEEKTWCVELRSGGSICGYAIIIAVGSEKRKLNVPGEKELTGKGVSY
    CATCDG
    PLFKDKIVAVVGGGNAAFTSALYLAKIASHVYLIHRRSEFRAFNVYVETARSNPKITILTNTIIKEIIGKNHLEAVRILN
    TESNKEEILKIDGLFIEIGLEPPVEFFRRIGLETDETGRARVNIDRSTNLPGIFVAGDAAGGPYKYRFEQIITAAADGAI
    AADAACKYICALKGPSST