Thermoplasma volcanium GSS1 uid57751

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|13540930|ref|NP_110618.1| dihydrolipoamide dehydrogenase [Thermoplasma volcanium GSS1]
    MYDAVVLGAGPGGYAAAIRLGQRKKKVAIIEKDKIGGECLNYGCIPSKAIIELANSINYLKEMPGVSINYNVDMKKWQEW
    KWSMINKLTGGVELLLKAYGVDIFRGTGYIQDKNHVKVNDKVLETDSLVIATGSKPVSINGINDVMYNREVLDLDHIPSS
    IVIIGGGYIGVEIGIALAKLGSKVTIVEMMPSILPGTDNELVRHVVRRMSQLGINVITGRKVLSTAKNGEVTVKLDDGQE
    LRAEKVLMTVGRIPNTEGFGLENLKLAMDGRFIKTDSRKMTSVKGVYAIGDVSGQPMLAHKAYYEADIAADNICGIDSEV
    DYRAMPYVIYSDPEIAYTGVKGAKSTRFPVAANGRSLTMNENIGTFNIYYDEKGIVTGAGIAAPHASELISEISLAVESG
    LMAMDIGLTIHPHPTVSEGVKESAEEVYGKPLHFKL

    >gi|13541033|ref|NP_110721.1| glutaredoxin [Thermoplasma volcanium GSS1]
    MATLIRKEDREYLKGEFDKYLKNDVDLVVFTSNDENCRYCKETVQLATEVSEINPKIHLKVYNFDEDKDQVKAYGVEKYP
    ATIVSKAGVEDGRIVYYGLPSGYEFGSLIEDLKNVSVGDADVSSKAAELISKIDKPITIKVYVTPT
    CPYCPRAVGTAHKF
    ALMNPNIKGEMIEALEFENEAEEVGVSSVPHIVINNDVTFIGAYPDDQFAEYVMEAYDHQ

    >gi|13541053|ref|NP_110741.1| peroxiredoxin [Thermoplasma volcanium GSS1]
    MSLVNKAAPDFEANAFVNGEVKKIRLSSYRGKWVVLFFYPADFTFVCPTEVEGFAEDYEKFKKKNTEVISVSEDTVYVHK
    AWVQYDERVAKAKYPMVEDRKGIIARAYDVYNEETGNAQRGLFIINPDGIVKYVVITDDNVGRSTDETLRVLEALQSGGL
    CPVNWHEGEPTLKV

    >gi|13541082|ref|NP_110770.1| mercuric reductase [Thermoplasma volcanium GSS1]
    MLSEKYDLVIVGRGAAAFSAAIRASEITSGQARIAMVGNGPLGGTCVNTGCVPSKLLISISNSFQNSLKPRYPGLPSVER
    PPETEVIMDFIRESVHGERKKKYEDVVESYENIDLYTGTAVFTGEKEILVDSSHSLFGYNVLIATGSRPYVPGIKGLNET
    SYITTDSVWELKHVPASIAILGGGAVGVEIGQALSRLGSEVHIIEVSNQILPGIPADMASIIERSLREDGMVINTSTSVD
    EVSGGEGKKYLKLNGTNINDTLEVEEILVATGRAPNIDLALEKTGVKYSKRGIAVDEYLRTSNRKIYAAGDVVDQKYKLE
    TLAAREGFISAENMFNHAMRTIDIFNVPFAVFCSPGYASVGYTQDEATKAGIKTEARRISTKDVASERIHANREGIINIV
    AEADTKEIVGVQIVAENAPELINEASAILSKRFKTDDLINTVHVFPTENEGLKLATQSFSRDITMMSC
    CME

    >gi|13541117|ref|NP_110805.1| peroxiredoxin [Thermoplasma volcanium GSS1]
    MSPKVNEKAPDFEAPDTALKMRKLSEFRGQNVVLAFFPGAFTSVCTKEMCTFRDSMANFNKFKAKVIGISVDSPFSLAEF
    AKKNNLTFDLLSDSNREISKKYDVLHQNFAGVPGLTASKRSVFIIDGDGIVRYAWVSDDPGKEPDYKAIQEFLSKMN

    >gi|13541250|ref|NP_110938.1| peroxiredoxin [Thermoplasma volcanium GSS1]
    MELLKVGDQAPDFETVDQSGSKVRLSDFKGQPVVLYFYPKDNTPGCTTEACNFRDNFNSFKEAGIKVIGVSVDSPESHKR
    FAEKYQLNFTLASDKEKEICKKYGVLGLATAKRVTYIIDRDGKIVYVYPKVTPKDHAVEVMNKIKELGLIPS

    >gi|13541303|ref|NP_110991.1| transporter component [Thermoplasma volcanium GSS1]
    MNENIGSINISSDAYKRDKSLFWKSVYALLILALALLIGGIIMQVLFHVTKAPLLLGLIVAFPLAIPLELWNFTDPDTLF
    RVMAFQDRFLMVCFGFAIGLGSIILYLVAIFTHPNFGIKDFFVPGIVIGGLIFGIGVGLAGYFPGTIWIALGQGRRDAIY
    ASFGGLLGAFTWSIIFGNVKWFFWDTLNFGPITWASVAGISSKFGVFAVSLVFGIILLLVFLLLPRYPKSKVKDSCGYHM
    LGKSEKTITFDLVISEDFEKYPKANRYLTKLINESSKENARMTIPLGLAFTITAVAVIILHQIFGESTTFSWIGAQLSYL
    ANPTWAASNAYFQLFGGLHMVNGVPVNHPFSEIGWEPFTDLSSFLGGLIAATLISKRYMAFKPQVPKIWSHSHNPKYRPI
    GAFLGAFMVLFGARMANG
    CASGHILSGNIQMAISSFVFMIFVLLGAWVTLRYFMHLKINSQGYTK

    >gi|13541307|ref|NP_110995.1| transporter component [Thermoplasma volcanium GSS1]
    MISVTAYEWIGLFIGMIIGGLAEAWGISNPEVLIRLGKWEDRLFIGCIAIAIGAGAIVLYGLSALGVSFHWGIKPDYVIG
    VALGGIIFGTGIAISGYVPGTVWMALGEGRRDAIYAVLGGLLGAASWTLIYQTSFGHWLTTYLNFGQIYFGGKVGTDLKL
    GFIIAIVWAIIMFVIAYTLPRYRKGKSCAYLSTHKNYKLDAEEEKEYIETANFLMEGTSMPIGKNNLPEKVNYHWTVSSK
    LFGVTMLSVGIIIGLTVVLEMFLHQIFGESTTYSWIVAQIWLPAGYWQYSTIVVHTIGWEPFSDIGTLFGAFLASIFFTR
    RFQAFSNVIPPSWKERFGNSQIKRAAGAFSGAYLMLLGARMADG
    CASGHILSGDLQMAVSSLEFFIFVVIFLLLVAHIIY
    RR

    >gi|13541562|ref|NP_111250.1| thioredoxin domain-containing protein [Thermoplasma volcanium GSS1]
    MANELVHEKSPYLLMHSNDPIDWMPWSERAFSKAAAENRLIFLSIGYSTCHWCHVIHDESFSDKDVADILNKNYVCIKVD
    REERPDLDSYFMNVSAVINGSGGWPLNVILLPDRRPVFAFTYVPKEDRRGMTGLKTLAQQIALIWKNDPQQFESQAVAVM
    DAVKNRMPGRAKINVDVFSKLELSLRTSFDLQDGGFSGSPKFFNTPALNYLLERFYETGNEEILNFIGLTLKTISIRGIH
    DLVNGGFFRYSTDTMWIVPHFEKMLYTQTQLMKLFSKMFMLTRDNVYRDMIYDIKRFMDENLYWPGHGYYSGMDADVDGN
    EGGYYKWSFQDLKVALGQDFEAFRAIFDISEGGNYMDELYGQTGDNLIYFTGSFDEYRRSIEENGSTDMLSRSIEKLREA
    EKKRKKPSVDKKILTDLNGLAISSLSWAYRATGDKEFLDSAVSVSEFIIKNMIGDYLLHSFFEGSASVKSSLFDYAFLIR
    GLIDLYTITFDQKYLEEAKKLADEAIKFLFDGKFKLSEEIDDPQIADSEVESPYATIVADLDDLSLLTEDLQYHQIADQA
    LTSVFDAVSRFPSAFPSMVISAEKHIYGKVVSCRANKVREAESIIPSEIALFSQLESEKYNICTYFACLNPVESIDVLKR
    SIYKLAD

    >gi|13541608|ref|NP_111296.1| thioredoxin [Thermoplasma volcanium GSS1]
    MACVKEINYEEYKELIGTSKSFILELWAEWCHPCKIMMPYLEEACEKLNACYFFRINVDKNPKIIDELNINSIPRIILFV
    NGEKTGEIKGFQKSDVIIEEASKILCDSPE

    >gi|13541612|ref|NP_111300.1| bifunctional methylated DNA-protein cysteine methyltransferase/deoxyinosine 3'endonuclease [Thermoplasma volcanium GSS1]
    MLSVDYENFDLISYLYNLVRQIPDGMVSTYGDLAEALGDPVAARSVGFMLSINKEPDYIPCYKVVPHDGSVGNYTHPLGS
    AEKMRRLIRDGITITNGHISNFEKVRFREFKTDYPLRKLRELQFKIGRLYDDRNDYSLDTIAAFDVSYKETRGYASKVVY
    NKGKIGAYVYSSDSMFPYIPGYLAFKEFKFIRALYDNETMILIDGNGILHPRFAGLATHAGVSLKTASIGIAKHLINCTV
    KGSDLLISGVVAGKMIGHHTIVSPGNRINVEEAGRLIEQREGKEMRSLLRLAHNLTRLHIETNGNIARYDFSTRNTAIQS
    S

    >gi|13541647|ref|NP_111335.1| NAD(FAD)-dependent dehydrogenase [Thermoplasma volcanium GSS1]
    MKIIVIGGGAAGMSAASKAKRVNPDSEVIVVESGSYVSYAECGIPYYLQGVVGHIEDLLHYPLSEFTEKRGIKVLLHTTV
    TRIDTLHSSVLLNNGDVLKYDRLIIATGSRPKPIDVISDRTISIRSLESAMRARNLIEKSKDVTIVGAGVLGVELASVLA
    ESGKNVKVISKYDRVLPQLDEDIGKIFHEYFSSRIDVQKQSSLKSAEEDRGRVKITTSVDDHECDAVIYATGIIPNSEIA
    VEAGIKTGDRNAILTNGHMETSEPGVYAAGDVATVRNIVTGLDEMMPLAQIANKAGRVAGSNASNSEMVFPGALGTTLVK
    VFDYEVGFTGINESRAKALGIPYEKTLIKAKSRANYYPGKQDIYVKIIYGKNDKRLLGAQVIGTDGAAWRLNTIATAIFG
    GFKVSDLFYDDLGYTPPFGPVWDSIVIAGSVSMRE

    >gi|13541661|ref|NP_111349.1| rhodanese-related protein [Thermoplasma volcanium GSS1]
    MLREDEESEIVKQFLDDNNSVIVDFDPIDLYEAVHPPFSIRLSIDRISAMPLSILRRRAAAFVSDPQTLSKLLNNDIAGK
    FDFIYDNSNRSWQKYYPFSYYRSINAADLYENIKAYTVLDVREPFELIFGSIANSINIPISELREKWKILERDKKYAVI
    C
    AHGNRSAAAVEFLSQLGLNIVDVEGGIQSWIEEGYPVVYGRESAED

    >gi|13541774|ref|NP_111462.1| molybdopterin/thiamine biosynthesis dinucleotide-utilizing protein [Thermoplasma volcanium GSS1]
    MLQDDYKYARQIALRVFNADDLKKIRNSVVSVIGVGGVGSLIADLFVRSGIKKLIIVDRDYVTSSNLYRQVLYDENDIGD
    SKAEAAKRRLSKVNSDVEIEARNETFDAGNAERIVSSSDLIMDGTDNLTSRLILNDAAVKNMKPWIMASAIETYGQVKAI
    IPEKTSCYRCYFSGEPFAQPT
    CAEVGVLSSLVTMVASIAWTLGIKVLTGKEVDGSLFNIDAWTQEIDRIAIDRMDDCECC
    VLKHFEYLSDRYKNIGLEFLP

    >gi|13541796|ref|NP_111484.1| putative inner membrane protein [Thermoplasma volcanium GSS1]
    MKRIYISGYIYGILLAVASFGLALLSYSITGVGLWWGVTGAESQMGGVFWSLFGLKIHNLAYYRVYPIPPFSEAFTWFLV
    FGIILGPLIVSSSKKEFSVRQVPNRYLALEAVAGGILIGYGTRMAGG
    CNIGDFYSGFATGSAWAIFFFLAMVSGIGTIIA
    LSRVLPHRIRKLAKVKSIFILPSERIQYSILGLTVGASILIIVFFSYTMVRLWYVFGLILGAIGYSGAMCFQTSFRETIS
    KNTGKTMARILAISLLVYSILSQMAIIDFHVKVNFFFDQSESILYQIIGGYIFGLGMGLAYN
    CTYSMEWRMGSGNVQAIL
    TFIGLTFIGAPLYALTYSWWHSFVPVVFEPTRYWEFSLYKYGVTGAFIIDLFPVAWLIYSYFSDKTLTTLSKNNPMDN

    >gi|13541930|ref|NP_111618.1| putative peroxiredoxin [Thermoplasma volcanium GSS1]
    MPVVLGQKAPDFTVNTSKGPITLSNYRGKWVLLFSHPGDFTPVCTTEFIAFTERYEDFQKLGVELIGLSIDSVFSHIAWI
    RDIKEHFGIDIPFPIIADIDKEVAREYNLIDEKSGATVRGVFIIDPNQIVRWMIYYPAETGRNIEEIIRVIKALQFNWDR
    KLATPANWQPGQEGIEPAPTTVDSSFKRDNEQGVKTWYLKFVK

    >gi|13541960|ref|NP_111648.1| thioredoxin reductase [Thermoplasma volcanium GSS1]
    MEFNLRSVSTEAKERDFDVIIIGAGAAGFSAAVYASRSGLSAVILDKNVAGGLTAEAPLVENYLGFKSIVGSDLAKNFAE
    HASEYASIREGVEVKSVKKGDGGFIVDTSDGEYHSKYIIITTGTTHKHLGVKGEAEYFGKGVSY
    CSTCDGYLFKNKNVVT
    IGGGNSGAIAAISMSEYVKNATIVEYMPRYMCENAYIEEIKKRKIPYIMNAQVTEIVGDGKKVTGVKYKDRSSGEEKTLP
    ADGVFVYVGLIPQTSFLKDSGVKLDERGYIIVDGRQRTNVPGIYAAGDVTSGSFAQIASAVGDGCKAALSLYSDTISSKK


    >gi|13542179|ref|NP_111867.1| hypothetical protein TVN1348 [Thermoplasma volcanium GSS1]
    MDPMERMTEIQKVFSASSKIKPDLTESFLSFMEKTLGKGELDVKTKSLVALALSLGLQCEWCITYHTKKCLEAGCTESEM
    METAYIAAIMAGTPALMNVNIMEEAIRGFNQTNSDSDISH

    >gi|13542217|ref|NP_111905.1| dihydrolipoamide dehydrogenase [Thermoplasma volcanium GSS1]
    METYDVITLGAGGAAYPAAFRLKKSGYSVLMIDKKGIMSGNCLAEGCVPSKAIIETVHNYSKLKKFGKYSIAYEDIVKHK
    DDVQNIRYKQHDEELHEAGLKILKGTAKLIDENTVEVETDTGKERYRAESIIIGTGSDTYVPKIPGAELAWTSRELYALN
    PKVRKLPKSIAIIGGGYIGLETASFMSLLGTDVTVIELLDRVLSTMDSGMVSKLVPLLPKMNLILSSPVKEIRRGGDMFE
    VSYDHEGKTEKIRVEAVLMAVGRMPMFPEGLDDLGIKYDKHGIKVNMAMQTNIKHIYATGDVNGLTPLFHAAKRQSLVAA
    NNIMANHVPVDYFDPLSVPFTVYTVPQVAYVGILPDQAKKLGISYIETDYQMEKDAMAQVNSEMEGEIRLFFDSRMKIIG
    GYVIGNDAGNLINEIALGISKGLSARDFAEMAHQHPMSFEGLDSAARKLY

    >gi|13542232|ref|NP_111920.1| stress-induced protein [Thermoplasma volcanium GSS1]
    MDTYTYKADVEWIGARRTILKTDAGDLEVSSPPEFGGPEGKFCPETLFPGILASCLLTTFLEFRERMGIDLKEWKSEATA
    ELGPSPEKGFRFQRIRIHVKLRVSEQDKEKIPRAMELAHKY
    CFISRAIKNNVEEIVDYEFI