Thermoplasma acidophilum

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|16081288|ref|NP_393603.1| alkyl hydroperoxide reductase subunit f related protein [Thermoplasma acidophilum DSM 1728]
    MANLIRKEDREYLKGEFEKYLKNDVDLVVFTSNDENCRYCKETVQLATEVSEINPKIHLKVYNFDEDKEMVKKYGVEKYP
    ATIVSKAGVEDGRIVYYGLPSGYEFGSLIEDLKNVSMGEADVSSKAAELISKIDKPITIKVYVTPT
    CPYCPRAVGTAHKF
    ALLNPNIKGEMIEALEFENEAEEVGVSSVPHIVINNDVTFIGAYPDDQFAEYVMEAYDHQ

    >gi|16081313|ref|NP_393630.1| peroxiredoxin [Thermoplasma acidophilum DSM 1728]
    MSLVNKAAPDFEANAFVNGQIKKVRLSSYRGKWVVLFFYPADFTFVCPTEVEGFAEDYEKFKKKNTEVISVSADTVYVHQ
    AWVQHDERVAKAKFPMVEDRKGTIARAYDVYNEETGNAQRGLFIINPDGIVKYVVITDDNVGRSTDETLRVLEALQSGGL
    CPVNWHEGEPTIKV

    >gi|16081346|ref|NP_393673.1| hypothetical protein Ta0195 [Thermoplasma acidophilum DSM 1728]
    MHVYESDVSWIDDRRTEVSVGDHRIEVDSPPEFGGPEGQLYPETLFPSVLASCLLTTFLEFKDRMGINLKSWNSHVTAEL
    GPSPEKGFKFHRIKIHVKIGVNDEDKEKIPRAMQLAEKY
    CFISRAIRNNVEEIVDYEFV

    >gi|16081358|ref|NP_393686.1| dihydrolipoamide dehydrogenase [Thermoplasma acidophilum DSM 1728]
    MEEYDVITIGAGGAAYPAAFRLKRSGFSVLMIDKKGVMSGNCLAEGCVPSKAVIETVHNLAKMRHFGDYSIDYSKIVDHK
    DSVQNIRYEQHDQELKEAGLKIIKGTARIIDDNTVEVSSDTGTSRYRSSSAIIIASGSETFVPKIPGAELAWTSADLYSL
    KPKVKKLPKSIAIIGGGYIGMETASFMSILGVKVTVIEMLDRVMSTMDEAMVDKLLPLLPKMDIRTASPVQSIERNGSMY
    HVNFGKEGEKESIEVEAVLMAVGRVPVFPEGIDDLGIEHDRHGIKVNMAMQTNIKNIYATGDVNGITPLFHAAKRQSLVA
    ANNIMANNVPIDYFDPLSVPFTVYTIPQMAYVGILPSQARKMGIEYLETDYQIEKDALAQINNEMFGEIRIFTDKRMKVI
    GGYVIGNDAGNVINEIALAVSKGLSLRDLAEMAHQHPMTFEGIDSAARKLY

    >gi|16081389|ref|NP_393724.1| hypothetical protein Ta0244 [Thermoplasma acidophilum DSM 1728]
    MDASEKLGEINDVFRLSKRVKPELTDRFLSFMESTLGKGSLDVKTKELIALSLSLALQCEWCIPYHTAKCLEAGCSEDEM
    IEASYIAAIMAGTPALMNVKIMADTIDQLKKK

    >gi|16081486|ref|NP_393836.1| thiol-specific antioxidant related protein [Thermoplasma acidophilum DSM 1728]
    MELLNVGDIAPDFETVDQYGKTVKLSSYRGKPVVLYFYPKDNTPGCTTEACNFRDNFNSFKDSGVEVIGVSVDSPESHKK
    FAEKYNLNFTLASDKSKDIVKKYGVLGLATAKRVTYIIDPDGKIAYVYPKVTPKDHALEVMNKLKDLGLVKNN

    >gi|16081579|ref|NP_393938.1| endonuclease V related protein [Thermoplasma acidophilum DSM 1728]
    MLGSIACSMEFEDFDLYSYFYGLVKQIPEGYVTTYGDLAQALGDPIAARAVGYMLSINEDPDTIPCYRVVLHDGTVGNYT
    HPLGPMEKVRRLRADGIPVVDGMIENFDRYRFRDFKTDQPLRKMQQYQEYIARKYSESGAGEFRTVAAFDVSYEERRAFA
    SMVIQDGSTIEAYVISDGINFPYIPGYLAFREFRFIKKLYRKADLLLIDGNGILHPRFAGLATHAGVLLDRASIGVAKHL
    TRSTRHQDIIYMQDRPVGVMIRKNMIVSPGNFIDVNGSADTVRKMWNDRYPWPLKLAHQLSTRHAETGGRVSEYSIESAH
    ELH

    >gi|16081586|ref|NP_393945.1| putative inner membrane protein [Thermoplasma acidophilum DSM 1728]
    MHFLHRRKDNSLYFVFYIMKFNTMYLYAVILALASFALAVLSYIISGQALWWGVTGAESQMGGIFWSLFGLHVSSLAYYH
    VYPIPVLDKAFTWFLVFGIILGSLIASLSRGEFSIRQVPNRNLAIQALLGGVLIGYGTRMAGG
    CNIGDFYSGFATGSFWA
    FPFFLAMISGIYTIVVLSRHRRTAGFFSSAKPRPSFIWPSRGIQYSILAAVIALLVLLIYLFPDPMVRIWLIFGLVIGSV
    GYLGSLCFQTSFRETIGESKDRQMIRLVAVSLLTVSILAQVTIFGLHMRTNFFFDQNQSVLYQVLGGFIFGLGMGLAFNC
    TYSMEWRMGSGNIQALITFMGLTFIGAPLYAISYSFWHSIIPVVVEPAPYWQFSIYRYGIIGAVIIDLFPVVWLLVFGYR
    KPSARSNERTDRKSVRARQDAD

    >gi|16081592|ref|NP_393951.1| putative peroxiredoxin [Thermoplasma acidophilum DSM 1728]
    MSGENMPDENKFPLIGEKFPEMTVETTHGSMKLPDQYKGRWFMLFSHPGDFTPVCTTEFYSFARRFEDFQKINTDLIGLS
    VDSTISHIEWVNWIRDNLKIEVPFPIIGDSMGRVATRLGMIQAESSTSTVRAVFIVDPNSTVRLIMYYPLEIGRNVDELL
    RAIKALQMSDKYRGAMPANWPYNELIGEKMLNPAPKNVKDATGRLKEFKGYAWWLTYKDVPDNEVQETKKIVKMREEK

    >gi|16082525|ref|NP_393982.1| thiamine biosynthesis protein ThiI [Thermoplasma acidophilum DSM 1728]
    MSLYMVRYSEIGLKGDRERSRMESILMDNIRKYYEIIGLRASCRIMSGHVLVEADGDGPLRHIMGIKSYSPVLRFRAETL
    EDITRIASEIYREKVRGKTFGVRCNRTGTHSFTSLDVERAIGDSLYDASAGVNLKNPDIWIHADIVGKDVFFYHEIIPGP
    GGLPLGSEGKYISLVSGGIDSPVSTWMIMKRGSPCDILFCSLSYPVDLRPFVDVVKKLVERWAPYRKPRIYVADCRSLIR
    TMVIEGRTKYSNVTFKRVIYRIAEKIALENGYNGIVTGESLGQVSSQTAENLKAIESGIGVPILRPLIGMDKDEVVDMAR
    RIGTFPELSMGEFCSLFASRPIIRSKPEDIDEDMKQIDMEELFEGIRAYDIDDLSVALRTDLSLKGSIPKDAVIIDLRSR
    SQYEKDHIPNSINLPLGDAINVEDKGRTYVVY
    CGMGLQSAYVASMLRNRGITAYYSTFSDLKKRLSEKESGNITGIDQPA
    E

    >gi|16081730|ref|NP_394114.1| hypothetical protein Ta0643 [Thermoplasma acidophilum DSM 1728]
    MEILSGRSSIIIDTDPINVYNQAHPPFSFPIPAKDVMSVASRPDLRNENLMVFSSIEGDLALLKSMNLPANVKIVYDNTD
    GSWVRYYPYAFYRSINAEELYAKIDDFVVLDIREEFELFSGFIEGSVNIPFSSIMQEPVELDKNRKYAVV
    CAHGNRSRVA
    VELLSSKGIEVYDVPGGMQKWLETGLPVSYEED

    >gi|16081764|ref|NP_394150.1| hypothetical protein Ta0679 [Thermoplasma acidophilum DSM 1728]
    MFSNVNKTTSAEAGKSAFWAMSIFLLLLSIMLLVLGLYYQIVLHHTPAPLLLGIAAGFGLGTPLEIWNFSDPDTLMRVMA
    FQDRFLIVCFGFSIGLGAILLYLFAAIPGVSPHYGIKDFFVFGVVVGGLLFGVGVGLAGYFPGTIWIALGQGRRDAIYAV
    FGGLLGALTWSLIFGAARGFFWNTFNYGPITWYSIFGIKSHLEIFGTSLIFGAILLGMFLFLPRYPKQPVKESCGFHLAG
    KNNKVLTFDDMIDDENKKYPDQNQYLIRLTNESSIRNARSIIVLGIAFTVIAVAVILLRQIFGESTTYSWIGAQLFYAVN
    PQYAASNPYWNLFGGMHIVNGKPIDLPFSEIGWEPFSDLGTFLGGLISSIFISKRFMKFKKRVPLVWEHRFGPSDKKRFV
    GSFFGAFLVLFGARMANG
    CASGHVLSGNIQMAISSFVFLMAVLIGSWLTLYFVMGLKLNSRGYRN

    >gi|16081893|ref|NP_394297.1| NADH peroxidase related protein [Thermoplasma acidophilum DSM 1728]
    MDIVVIGGGAAGMAAASKAKRVNKDANVTVIESGSFVSYAECGIPYFLQGIVGKAEDLLHYPLEEFTEKRGIKVITGRVV
    KKIDTASLSLVLDNGSAVKFDRLIIATGSRPRIPDGIASGVFGLRSLESAIRLKEAIDGSRTITIIGAGVLGVELASTLT
    EAGKRVKVISKYDRVMPQLDPDMGKILNDYFSSKVEVEFSSTPVEIKKGEDGFAVKTTVDDHVSDVVIAAVGIVPNSNIA
    VDAGIKVDQRGAIITDEHMETSIPGIYAAGDVATVKNIITGQDEMMPLAQIANKAGRVAGSNAAGSEMRFPGAIGSTLVK
    VFDMEVGFTGLNEKRASVLGIPYGKTMIKAKSRANYYPGKEDIFVKILYDSRDKKIIGGQVIGKDGAAWRLNTLATAIFA
    GFTVEDLFYDDLGYTPPFGPVWDPLVVAGSVSMRE

    >gi|16081900|ref|NP_394304.1| molybdopterin biosynthesis protein moeB related protein [Thermoplasma acidophilum DSM 1728]
    MMPEDYKYARQMVLRQFDKDDIAKIRRARILVVGLGGVGSLIADLLVRSGVKKVVLIDRDYVSSSNLYRQTLYSEEDIGD
    SKVEAAKRRLQKVNTEVEVEAINETFDATNAEALVSSVDLVMDGTDNLTSRLIINDACVKLKRPWVMASAIETYGQVKAV
    IPEKTSCYRCYFTSEPFAQPT
    CAEVGVLNSLVTAISSIAFTLAMKILTGKEVDGSIYNLDIWTMDLDKIAVDRREDCPSC
    GLHQYEYLTDRYKNIGLEFMP

    >gi|16081919|ref|NP_394325.1| thioredoxin related protein [Thermoplasma acidophilum DSM 1728]
    MKNYMGCVKDITFNDFNRLIDEKKSFIIELWADWCHPCKIMAPYLEEACQKLNACYFYKINIDENPEIVDTLNVNSIPRI
    IMFVEGQRQAELKGFQKLQSIIDQISKIPCDSV

    >gi|16082572|ref|NP_394414.1| putative peroxiredoxin [Thermoplasma acidophilum DSM 1728]
    MPVTLGQKAPDFTVNTSKGPVTLSSYRGKWVLLFSHPGDFTPVCTTEFIAFTERYKDFQALGVELLGLSIDSVYSHIAWI
    RDIKEHFGIEIPFPIIADIDKEVARQYNLIDEKSGATVRGVFIIDPNQIVRWMIYYPAETGRNIDEIIRVIKALQFNWER
    KLATPANWQPGQEGIEGAPSTVDASLKRDGEPGVKTWYLKFVK

    >gi|16082022|ref|NP_394444.1| thioredoxin reductase [Thermoplasma acidophilum DSM 1728]
    MEFNLHAVSSEEKERDFDVVIVGAGAAGFSAAVYAARSGFSVAILDKAVAGGLTAEAPLVENYLGFKSIVGSELAKLFAD
    HAANYAKIREGVEVRSIKKTQGGFDIETNDDTYHAKYVIITTGTTHKHLGVKGESEYFGKGTSY
    CSTCDGYLFKGKRVVT
    IGGGNSGAIAAISMSEYVKNVTIIEYMPKYMCENAYVQEIKKRNIPYIMNAQVTEIVGDGKKVTGVKYKDRTTGEEKLIE
    TDGVFIYVGLIPQTSFLKDSGVKLDERGYIVVDSRQRTSVPGVYAAGDVTSGNFAQIASAVGDGCKAALSLYSDSISKK

    >gi|16082029|ref|NP_394451.1| hypothetical protein Ta0991 [Thermoplasma acidophilum DSM 1728]
    MPNELSRSLSPYLLMHANDPVEWRMWSKETLRIATEENRLIFLSIGYSSCHWCHVMHEESFVDPDVAEILNNNYIPVKVD
    REERPDLDSYFMKVSQVINGNGGWPLNIILLPDARPVFAMTYVPKEDRNGMTGLKTILIQLSQMYLKDPDQFKDQAKAVS
    DAMEERESVPSKVTPGIDDRLYDSISRYLDRTDGGFFGQTKFYNVPVLEFLMDRYEKTHDENVSDFLKTTLMTIAVRGVH
    DPLFGGFFRYSTDSMWIIPHFEKMTYTQAQLMRAYAKMYLLFHDDFYLRIVEDIFSFMDRYMYSGASYYTSMDADYDGIE
    GGHYLFSYEEIRKYLEDDFPQFTKVFEVHENGNFSDPYGENRGKNFLYFAGTPEEFIKLMSIPEIQRSVQHGLEKLRNIR
    EKDAVFIDKKELVDLNAMMVSGLAWAYRATDDKRYLERATIVSGWLKDLNKDRICHGVFNGNIIETPTLQDYAFLSEAMI
    DMFQITFDGKYLEDAYRYAEQAMMLIKEGKISYSSEVFDADPTDGEVESPYAVMIRVFDQLSLLMDNMDLHERSDSLLTS
    IFGNAQSFPAAYPSIVRTAEFHLKGKHVSSNKNMIDAIMKKSIYHNALFSLEEVDQYVICGYGMCFPPAHTIEEAVDKIK
    S

    >gi|16082328|ref|NP_394797.1| mercuric reductase [Thermoplasma acidophilum DSM 1728]
    MSKEYDLLILGYGAAAFSAAIKASEITSGQASIAMVGTGPLGGTCVNVGCVPSKMLISAAKNLKYIAKPRYPGLKATYAV
    ETGEVMDFIRMAVDEERHNKYEAVISGYENIDLYRSRAVFTGDRRVKLDDGQELFGYNVLIATGSRPSIPAVPGLANAGY
    ITSNEFWALERIPESLVIIGSGPIGSEIGQAAARLGSRVHIVEIADQILPGISKDMAQMVMDAMASDGVEFSLSSMVKDV
    SVRNGKKIVRFEKNGVQHEIEADEILVATGRSPNADLDLEKTGVKYDRYGIEVDSTLRTSNRKIYAAGDVVKQRLKLETL
    ASKEGVIAAENMFDHAGISVDLNSFPVAVFTSPEYASVGYTEDEALKAGLNYDVRSIYTTDVPKERILRNDRGMIKIVAE
    QGTGRIIGIQIVAENAADMINEASAILHAGMTVGDVIDTPHVFPTVNEGIKLAAQSFLRDISMMSCCME

    >gi|16082329|ref|NP_394798.1| mercuric resistance operon regulatory protein merP related protein [Thermoplasma acidophilum DSM 1728]
    MKKVEMKIYGMTCDDCAVTVKNGLESVDGVLSAEVSLPEKRAEVVIDESKISPEKLEDARVFKVTRYRGEVRKIE

    >gi|16082618|ref|NP_394824.1| peroxiredoxin [Thermoplasma acidophilum DSM 1728]
    MAVKVGDKAPDFEAPDTNLKMRKLSDFKGQKVVLAFFPGAITSVCTKEMCTFRDSMANFNKVNAKVIGISVDSPFSLAEF
    AKKNNLTFDLLSDSNREISKKYGVLHENFVNVPGLTASKRSVFVIDKDGIVRYAWVSDDPGKEPNYKEVQDFVSKLN

    >gi|16082404|ref|NP_394889.1| dihydrolipoamide dehydrogenase [Thermoplasma acidophilum DSM 1728]
    MYDAIIIGSGPGGYAAAIRLGQRQKKVALIEKDKIGGECLNYGCIPSKALIELANSINYLREMPGVSLNYSIDMKKWQEW
    KWSMINRLTGGVETLCKGYGVDVIRGEAYIVDATHVKIGEKVIEGKNLVIATGSKPVRIKGIDDVMYNREVLDLDHIPES
    TAIIGGGYIGVEIGTALAKLGSKVTIIEMMPSILPGTDQELVRHVERRLSQLGVRVMTGKKVLNTQHGDKIRVNMEGGEY
    VEAEKVLMTVGRVPNTEGFGLENLKLEMDGRFIKTDAHKRTSVPNVYAIGDVSGQPMLAHKAYYDADIAADNICGMDSVV
    EYRAMPYVIYSDPEIAYTGSKSAKSTRFPVAANGRSLTMNESIGTFNIYYDEKGIVTGAGLAAPHASELISELSLAVESG
    LMAMDIGLTIHPHPTVSEGVKETAEEAYGKPLHFKI