Thermofilum pendens Hrk 5 uid58563

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|119718958|ref|YP_919453.1| glucose-inhibited division protein A [Thermofilum pendens Hrk 5]
    MAGTHMKKYDVVIVGAGIAGLTAALYAARQKLSTLVVSADLGGQLLLTTEIQNFPGFMSIGGLELIRRVEEQAKTYGAEI
    VFDEVVGVEEREGVFVVKTASGAEYASDALILAFGKSPREMGVPGEREFKGRGVSY
    CVICDAPLYRGRRVALVGWGAHNY
    ENIILLRDYASKVYWVFPGEKPIEEDELLREALSKGNVELVPFSEPAEVKGDKRVQALVVRDKRTSELRTLEVDGVFVEI
    GYVTKTGFLRGFVELNEKGEIVVDKACRTSRPGVFAAGDVTEMPHKQAVIAAAMGACAALSAYAYVMEKRGRKVVSTADW
    RHVEIPGKKKEGGGLAIKLR

    >gi|119718976|ref|YP_919471.1| thioredoxin/glutaredoxin-like [Thermofilum pendens Hrk 5]
    MLTVYVHPRCADSYRVYRLLSSRTPQSTRITYLDTEKYPFRALEYGVFSVPAFSLNGRLVLQGYFEDEEVVSLASGAGLR
    VSSLDEAFSRLLKSVYYSLTVASAVYVAGDLSVVAGSKSYLMSASGAFFVPEGEKFPEYAARRLSQTPFSEVEQGLLRNI
    AGNFARDLYWLTGEVPTRERVEKLGEGFFEAWLLARASIGRVFVPQSSPRPGLRERVSKAWSYVLGVIDKAGARVKEEQE
    SIPQGWVEEASAQA

    >gi|119719061|ref|YP_919556.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Thermofilum pendens Hrk 5]
    MRSTMVEKVDVAVIGGGPAGMTAASRIKRLKPELRVAVFERSGYVSYAPCGLPYYLGGLVDSLEHLVHYPVRVFTEERGI
    EVYTRTEVVEVGDGYLRARDASGERTYEWGKLLIATGARPKVPPVEGVDLEGVFTLRVLEDGEKARRYLEKATRVAVVGG
    GYIGLEVAENLVRAGKTVLLFEVLDHVFPAVDPDMALLVEKELARNGVELHLGEGLKGIHGRDRVESLETTKGEYKVDAV
    FIATGVAPETRLAEKLGVKKGSTGALSVDKSMRTNVDDVYAAGDVAEALNLVTGKNDWFPLAPVANKMGYVAGAAMAGLK
    AEFPGAVGTSITKVFGLEVGRAGLTTARAQQEGFDPVSVMINANSKASYYPGSSAMSVKLIADRRTGQLLGGQIIGGDGV
    LARLNSLAVLLSFRARVEDAFFSDLGYAPPFSPVWDPIVTAARVLLGKIREA

    >gi|119719078|ref|YP_919573.1| methylated-DNA--protein-cysteine methyltransferase [Thermofilum pendens Hrk 5]
    MVNIEASCFSTPIGELCGIVRGNVVLYLHRPLLLSGVTRGEFAERLRREIEEYFSGRRKSFSFRPLIRGSALRKKVFEEV
    LRIPYGSTITYGELAARVGSSPRAVGRVLSENRILLVIP
    CHRVVASKGVGGYAFGVEAKKYLLRLEASNR

    >gi|119719144|ref|YP_919639.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Thermofilum pendens Hrk 5]
    MSGKTIVVVGGGFGGFYALKTLSGLGLTERNRVVLVDKSRRFVYLPSLPYLISGKKTVEDLTEPLEEIAKRLGAEFLLGE
    VTRVSLQEKTIELSNGEKLRYDYLVLAAGATTEYYGIPGAHQALPAWRLEDYERIVRELGKCGSG
    CRVCIAGGGLTGVEV
    AGEVAEKYEGKSEVVVVEKMQMLMPTLNSQRASKIIEEFLSSKGVRIIKGNGVSSVSEKNLNLEDGTSIQCDIVVWTVGV
    RPPDIRFDVDVPVKGRGWICVKPTLQVMSRDDVYAIGDINHFAVDSDYAMKMAEEAILQGKTAAKNIALQISGETPRYTH
    KPIFLASKPKSLVSVGYGRALMIWENKILFGRAPYISKMLIESIVMRDVKGKVGGGIATSLESKILRTISG

    >gi|119719237|ref|YP_919732.1| thiamine biosynthesis protein ThiI [Thermofilum pendens Hrk 5]
    MEGLREVFVVRLGEITVKSKKSRERFEKRLLENIRDALSSSGVSGEVRREYGRIYVYAPSSFAGVLRRVFGITSFSMALE
    YEFKALDDIASTVYNLYCDKLKGKTFAVRARRTGDHPFTSMDVARKVGEKLYPCSSGVDLSNPEVQVFIEVRGSRAYFYT
    DVVRGYGGLPVGSEGKVLALISGGYDSAVAAWYMLKRGAEVHYLYCNMAGDLTKSLVLSVAKKLADSWSYGYKPRLYVAD
    FSPLLRELRAKVAPELFGVVLKRYMYRVAEAIAGRIGAIGIVTGESLGQVSSQTLENLYVASQATSMPIYRPLIGFDKEE
    IISKSKEIGTYEESSKVKEVCGVFSVHPKTRSRLEEVEREESKLDPAILGRVLSTVEEIDLRSATPSPLIEVDVDAPPEG
    SIIVDVRPKEKYEEGHIPGSLHIEFTELPLFLERLDKSKTYVFV
    CDEGGLSREAAYMLRKAGFNAWSLKGGLRRFSRLAR
    ESSG

    >gi|119719243|ref|YP_919738.1| glutaredoxin-like domain-containing protein [Thermofilum pendens Hrk 5]
    MPVEYDEELVNDLRQMFQALENPVSIKWFVDPGSECVYCDDTEQILNLVQQVSGGKVRVTRYTSKDPEAKKYSIDMFPAI
    LIHGVDEWNVRFFGIPAGYEFGAFVEDIIDASTGRVNISPEIREILLKYVTKPTRIMIFVTPT
    CPYCPIAVRAAHRFAMV
    NKNIYGDMIEALEFSDLADRYGVYAVPKNVIQVNGEDKNEFEGAAPDPYFVAKILEAYGVEIPRSLQEAIAGIEAQYTEE
    TYEDEELHHHHHHHH

    >gi|119719342|ref|YP_919837.1| thioredoxin domain-containing protein [Thermofilum pendens Hrk 5]
    MSCRGLPSVSHVELKGLLSEKKVVVVDFYADWCIPCKVVDDMLLRVEKLFERYDSVCFVKVNVDTEKEVAAEYDVLGLPT
    VIVFAAGKEVKRYTGVPRSLISDLAATVKSLL

    >gi|119720035|ref|YP_920530.1| thioredoxin [Thermofilum pendens Hrk 5]
    MEEVELIKRRMLRELVSRRGSTAGSARCPYERWARAPTFNDALSKCKVALADFWAEWCGPCRLTEPIFEELAAKYAGRVA
    FLKVNVDENPDLAVQYDVMSIPTMIVFKGGKEFKRFIGYSPLLARQLDLTLQGLIAG

    >gi|119720317|ref|YP_920812.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Thermofilum pendens Hrk 5]
    MPRNRLIYFRASQPLMAGPIFILRDYLRCSGCRLCEVACSLKHEGTVWPEASRIRVFEFFPGVDVPHLCAQCRDYPCVKA
    CRYSALRVDESTGAVLVDGEKCTGCGDCVRACPGKVMRLHPETRKAIVCDLCGGEPECVKACHEAGFDALRVVPYTSVGF
    KVYSTMPDQVAQRLFETLFGGE

    >gi|119720333|ref|YP_920828.1| cytochrome c biogenesis protein, transmembrane region [Thermofilum pendens Hrk 5]
    MGLTARWTPRPRASAPSGLHAFSAHRVRASAGLRETVIFHLDTRVYAMKTWKLSLNSPAKSRRLGWRALVAMVALSAVLS
    VALLYARSQRPAEPYLLASSSEVYSAVSSGGAVAIMFSSPT
    CPVCEKMEPYWAALASRGGVLAVRFYVVRLGEGTAEAFY
    KYGVTSTPTYILFLDGRVAARYVGEFPGPNVTQSMLSWVLASLVQPLPQAGAPQGNSCEAGSCPVEPRSQGSGLPLVAAV
    VSFFAGVLAAFSPCTLPLLIAHAAASARVGARASRMAGGCFAASASSILALGLLFALLSKALSVAHAVLTSFTAILLLLL
    GASGVAGYRVDLPAVLPGGRLGVYGRCGLFGFLSVQCNLPLVLGPFLAVVGTSMEDFSEALYLALGYSLGTSSVLALALS
    GSGKVASLFERALYREDLVNRLSGLLLIAAGTLLLFQPYA

    >gi|119720335|ref|YP_920830.1| redoxin domain-containing protein [Thermofilum pendens Hrk 5]
    MVSGVVSVGEQAPDFEAESTGGVFRLSSLRGRRVVLFFFPKAFTPGCSRELSEFSELYEEFKRLGAEVVGVSADKVNTLR
    KFAKRYNAAFNLVSDPSLEVAGKYGVVGRSGKTAERVTFVIDEQGVVRAVLRDLPRAEDHPHAALEALKSLAGQQP

    >gi|119720473|ref|YP_920968.1| peroxidase [Thermofilum pendens Hrk 5]
    MSEIRMPLLGEKAPSFTAKTTHGVINFPDDFRGKWVVLFSHPADFTPVCTTEFVSFQKKMEEFKKLNVQLIGLSIDQVFS
    HIKWVEWIKEKLGVEIEFPIIADDTGEIAKKYGMIHPGKGTNTVRAVFVIDPNGVLRAVLYYPQEVGRNMDEILRLVKAL
    QVSDKHGVALPANWPNNELIGGKVIIPPASDEKTAKERLEKAARKEIECFDWWFCYKSLEK

    >gi|119720693|ref|YP_921188.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Thermofilum pendens Hrk 5]
    MLYPLFHSFSLESLNSWFDWFLTNTMSGDEAFNVTKKQSFRVTRRDFVFFVAKVAVLTGIVTSVPLVAAKTVDKRRPPGA
    VDEAEFVVVCARCGRCAEVCPQKIIVQVPVWESVVAAGTPVLVDGGV
    CVLDFKCVDVCPTGALQRLPKEKAKMGTALLDK
    DKCIGCGA
    CVSVCASIAGAIKWRKSGRKVEVDAAKCLGCGACVKECPVGALSLTPSGAYRPSWKWPKGG

    >gi|119720727|ref|YP_921222.1| dihydrolipoamide dehydrogenase [Thermofilum pendens Hrk 5]
    MVKHYDVIVFGTGSAMNIVSELINEGKRLRFAVIENNMVGGICLTRGCIPSKMLLEVARNIRRIKEAEKFGIQVSLAGVD
    FTGVMERVWRRIYAESKEIEHSLKHHPLIDLYQVDGTFVGDYTVDVGGREIEGDTILLCTGSRPHVVKAPGVEEVKYYTN
    DNFFRELRKLPRRTVVIGGGFVGLELGFFLAMMGSQVTVLQRRERILPEEEPEISELLARDLSRYMDIRTLHEVVEFRRS
    GERQIVVAENKATGDNVEFEADAILMAAGRESYSDITRPEKTGVKTDEKGWILVDEYLRTTKDGVWAFGDATGKMMFKHK
    ANYESVIVYRNAFRGENVKARYHAVPHAVFTEPEVASVGLKEEEAAKKYDILVGIAGYEETAKGEAMMLHDYFVKVILDR
    DTFRILGAHIIGPEASILIQEIVNLMYAGDGTAEPIYEGMHIHPALSEVVERAFFHLHEPGEWRRHAHH