Thermococcus sibiricus MM 739 uid59399

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|242398255|ref|YP_002993679.1| NADPH:elemental sulfur oxidoreductase [Thermococcus sibiricus MM 739]
    MVMKKVVIIGGGAAGMSAASRVKRLKPEWDVKVFEATEWVSHAPCGVPYVVEGISPKEKLMHYPPEFFIKKRGIDLHLNA
    EVIEVEQGSVRVREKDGEHTYEWDYLVFANGASPRIPNIEGIDLKGVFTADLPPDAVAIREYMEKNDVRDVLVIGTGYIA
    LEMAEAFVVQGKNVTLIGRSERILRKTFDKEITDIVEAKLREHLNLRLNESTLRIEGKDRVEKVITDAGEYKADLVIIAT
    GIKPNTELAEQLGVKIGETGAIWTNEKMQTSVENVYAAGDVAETRHLITGKRVWIPLAPPGNKMGYVAGSNIAGAEISFP
    GVLGTAITKFMDLEIGKTGLTEGEALKEGYDVKTAFIEARTKPHYYPGAKKIWLKAVADKETGRLLGLQAVGAEILPRVD
    ALAIALQAGFTTKDLFFADLAYAPPFAPVWDPLVILARVLKF

    >gi|242398756|ref|YP_002994180.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Thermococcus sibiricus MM 739]
    MKTYEYDVIVIGGGPSGLAAATKLAEKGYSVGLVERKEELGGILDQCIHDGFGTKIFKKTLSGLEFSAFFIQKVHSSNIE
    THLNTYVKDMRIDKNKKEILTISPEGVKKIKAKAIVYALGCRERHQFEIKIGGTRPAGVYTAGMVQRLVNLYGILPGKNI
    LIVGGGDVGMIVARHLHLEGAESILIVFPEERFAGLPRNVQQCVLDFKIPYRPRTIVKEIVGKERVEGAILAKVDEKWQP
    IPGTDEFYPCDTIVLSVGLIPYSRKLKNIGAEIDPKTKGPVVNEFFETTVDGTFAVGNLVQIFDYVDDAVESAFMAAEGV
    EKYLNAEPKGERIELTPGKSIRTLTPHVIEWKDERNIVAFFRPGLEKENVYVELRDEKGTLLKRYFRRYIRPSTLERIEI
    PREILKGTKKVVLDVGES

    >gi|242398974|ref|YP_002994398.1| Protein disulfide oxidoreductase [Thermococcus sibiricus MM 739]
    MALISDGDKKIIKEEFFSKLVNPVKLLVFIGKDHCQYCDQLKQLVEEISELSDLVTYELHDFDSEKELAEKYRIDIAPAV
    VMTQNGKDLGVRYFGLPAGHEFGSFLEDIVDVSKGETDLSEETKEALKEINKDVQIYVFVTPT
    CPYCPMAVRMAHKFAIE
    HALAGNDRILGDMIEAIEFPELAEQYGVMAVPKVVIKVNGEDKISFEGAYPEKMFLEKLLEALE

    >gi|242399002|ref|YP_002994426.1| Methylated-DNA--protein-cysteine methyltransferase [Thermococcus sibiricus MM 739]
    MISIKSFQIGEKEIVIAILFDKKIQGITFSFDGEQFLQERVNALVEHLTNRGVKVNLEERDSELPALVYKILIGEIRNQD
    GLEYLSFEGTTPFEKKVYETLTKKVKRGEVITYGELAKMLRSSPRAIGGAMKRNPYPIIVP
    CHRVIASNNIGNYTPKREY
    KRFLLETEGVKTWTS

    >gi|242399113|ref|YP_002994537.1| OsmC-like protein [Thermococcus sibiricus MM 739]
    MNLLKHYTQKFNGDVMPEYKDMVLKVVGERLSPMKMKVRAGNFEMVMDKLGGEAPSPIEYVLAALAGCINIVATLVAQDM
    GINIEDLSVEVEGVFNPAKFLGQENGRAGYKEITAKIKVKTDADEETLKKWLEQVEER
    CPVSDNLSNPTPIKVEFEKC

    >gi|242399130|ref|YP_002994554.1| Thioredoxin reductase [Thermococcus sibiricus MM 739]
    MKEMFSLGSLSQSGIDETKTWDILIIGAGPAGFTAAIYSARYGFDTLIISKDIGGNVALTDIIENYPGFPEGVKGSELAN
    KMHEQVKKLNVPIVFDEVERVDPAECAYYEGPCKFEVKTKNGKVYKARSVIIAVGAEPRKLKVPGEDKFYGRGVSY
    CATC
    DGPLFRGKHVIVVGGGNTALQEALYLNEIGVNVTLVHRREEFRADKILQERFKKAGIPVLLNNVVVEIKGNQKVESVLLR
    NIKTGEIFEKKVDGVFVFIGYEPKTDFVKHLGITDEQGYILVDMYMRTNIKGLFAAGDITNVFKQIAVAVGQGAIAANSA
    KDILENWKSQMNEE

    >gi|242399300|ref|YP_002994724.1| NoxA-2 NADH oxidase [Thermococcus sibiricus MM 739]
    MKIVVIGSGTAGSNFALFARKLDRKAEIIVIGKEKTMQYSPCALPFVLSGKIPKLEDIVVFPNEFYEKQKIQMMLETEAK
    TIDRKRKVIITDKDEVPYDKLVLATGSKAFVPPIKGVEKRGVFTLKEMRDVREIQEYIKERKPKKAVVIGAGLIGLEGAV
    AFRELGMEVLVVELLEHLLPTMLDKDIASIVQSHLEERGIQFRFGVGVSEIIGDPVTAVKIGEEKIESDIVLVATGVRAN
    VDLAREAGLEIKRGIVVDEYLRTSDPDIYAIGDCAEVYDAVTGERILSQLGTTAVRMAKVAAENVFNKNVKFKPVFNTAI
    TELFDLEIGTFGITQERARKEGIEVVVGKFKGSTKPEYYPGGKPITVKLIFRKDNKKLIGAQIVGGERVWGRIMALSFAA
    QKEATVEDIAYGETAYAPPISPTIDPITVAAEMALRRFK

    >gi|242399493|ref|YP_002994918.1| NADH:ubiquinone oxidoreductase, NADH-binding subunit F [Thermococcus sibiricus MM 739]
    MSEIKAIAVGMNSCGIAAGARETYEAVKEELEKRNLDIKLKIVGCVGMCYREPLLDIITDNEIITYGHVTPDRVPRIIEE
    HVINGKPIEDWVVKKDWWENGQRKTWDFDGYFVKQKKIVLENSGYIDPENIEEYIAAGGYEALKKAFKMKPEEIIDFITK
    SGLRGRGGAGFPTGLKWKFTRDAPGDEKYIVCNADEGDPGAFMDRNVLEGDPHRVIEGMIIGAYAIGATKGFIYVRAEYP
    LAIKRLRIALKQAREKGFLGENILGSGFSFEIVIKEGAGAFVCGEETALIASIEGKRGMPRPRPPYPAQKGLWGRPTNIN
    NVETWANVPWIIKHGWEAYAALGTEKSKGTKVFALSGKIKHGGNVEVPMGITLREILYEIGGGTKTGKKIKAVQLGGPSG
    GCIPDYLFNTPVDYESVTATGAIMGSGGMVVMDEDTCMVDVAKFFLDFTVKESCGKCTFCRLGTKRMWELLDKITKGEGA
    LEDIEKLEKLAPLVKTGSL
    CGLGQTAPNPVLTTLKYFKDEYLAHIEGRCPAKVCKPLIKYVIITEKCTGCTACAIMCPVK
    AISGERGKPHLINQEACIKCGTCYEVCRFNAIEITDAKKEGE

    >gi|242399673|ref|YP_002995098.1| Predicted stress-inducible protein, OsmC/Ohr family [Thermococcus sibiricus MM 739]
    MGMKRLEYKAELKWDGNVGSEVKVRGFSFKIDTSTDGRNAGPNPTEYLLAAIGGCLTVNWGRLIKKMRLKVDEMHVIVSG
    WRDQEEPRLKEITYKVRIVTEEPEKKVLRVKELAEKYGTVFNTVGAEKIKGEVEIVRKGRLDAVKD

    >gi|242399678|ref|YP_002995103.1| Thioredoxin [Thermococcus sibiricus MM 739]
    MIHEYDGKIDFNRGKVVLWFSIQGCPPCRLVESFMEEVSEEFSEIRFIHVGAEKWSNIVKRFEVLNVPTLVYLKDGKEVA
    RQNLIRSKEEVLAKIEELHEC

    >gi|242399679|ref|YP_002995104.1| Heavy-metal transporting P-type ATPase [Thermococcus sibiricus MM 739]
    MKITLKVNGMTCAMCVKTIEIALSQLEGVKTAKANLNSETVFVDFDESKVSLNKIIQAIEDVGYEVIRERKNVVVKVGGM
    T
    CAMCAKTVEKAIDELPGVLDVSVNLATETARISYNPSSVDVEDIRRAIEGVGYDFLGVEGEETRDIEKEVRERHLKEMK
    RNLLIAWGVGIPLFLSMQLKRFGIHIENLIYVQFILATMAIAYAGRGIFKKAYSSLKHKTLNMEVMYALGIGSAYLTSVL
    ATFGLVPREFNFYEASVLLMAFLLLGRFLEARAKGKTSEAIKKLIGLQAKKATVVRDGKEIEVPISEVKVGDIVIVKPGG
    KIPVDGVVIEGESYVDESMITGEPIPSLKKFGDKVIGGTINKNSVLKIKAEKVGRDTLLAQIIKLVEEAQNTRPPVQRLA
    DTVVTYFIPAVLVIALLSFAYWYFIAGKPLVFGFTTLLSVLVIACPCAFGLATPTALTVGIGKGAEMGILIKNGEALEIA
    RKATVVLFDKTGTLTKGRPEVTDVITFGMDEKELLRLVASAEKRSEHPLGEALVKKVQEMSLGLEEPEEFEAITGKGVRA
    VVGGGEVLAGNRKLMTEQGYSVEDVEEELQKLEDEAKTAIIVAIDGKIVGIIGIADTIKEGAKEVIEELHRMDKKVGMIT
    GDNKRTANAIAKQLGVDYVLAEVLPQDKAGEVKKLQEKGEIVIFVGDGINDAPALAQADVGIAVGNATDIAMESGDIVLV
    KNDPKDVVKAIKLSQKTIGKIKQNIFWAMFYNTILIPFAAGLAFLLFEITFQPEWAAGAMSLSSVSVVANSLMLKRVKI

    >gi|242399692|ref|YP_002995117.1| Alkyl hydroperoxide reductase subunit c [Thermococcus sibiricus MM 739]
    MKIMVMVGETVPDFEANAYFPEKDEIGKLRFSDYRGKWVILAFYPADFTFVCPTELEELAKYYEEFKKEGAEIISVSTDT
    AYVHKAWHDTSPSIKKIKYPMLADPAGKISRLFGTYIEDEGVSWRATFIIDPDGKVVSMHIHDNSIGRSAKEILRMLRAS
    KYVREHPGQVCPASWEPGKETLKVSLDLVGKI

    >gi|242399699|ref|YP_002995124.1| Molybdopterin biosynthesis protein moeb [Thermococcus sibiricus MM 739]
    MVVYVDVKMDFSRHFPIIGIEGQRKLSESTVTVVGAGALGSWEVYFLHKLGVGKIIVVDRDFVDESDLPRTIYTKEDVGK
    PKVEALKERFGVIGHFEDLNPSTVNLLDEADLIIDGTDNIYTRQVINDYAVKNNKPWIYVGVLSTYGNIMPIIPRKTACF
    RCLMPKLPERPMPT
    CAVAGIMSYVPSLATSIAVGLAAKILLGEEIKSELIFFDTKTLEFERVEVPRREECPACVKREFTF
    LEKRIKIERLCDGSIQITPPEPMNINLDEFAERLEKLGIEYLKTSQFIQFEDEDYEILVFKSGRMVVRGAEEEREAKNLF
    ARYLGG

    >gi|242399721|ref|YP_002995146.1| Glutaredoxin/thioredoxin-like protein [Thermococcus sibiricus MM 739]
    MKFSWGEKMDELEMIRRKKMLELMKKAGIIEVKQEKPKVIIEVITSPGCPYCPIAWAMAQEIARKYDGIIAKEISVATPE
    GQRKAREHNIMGTPTILINNRVEFIGVPNFAEFERRVRQYLSA

    >gi|242399846|ref|YP_002995271.1| Peroxiredoxin, bacterioferritin comigratory like protein, AhpC/TSA family [Thermococcus sibiricus MM 739]
    MEYLNIKVLDEDGNEKPLSDFVLGKWTVLYFYPKDNTPGCTTEAKEFTELIEEFEKLGFQVIGVSCDSPKSHRKFKEKHG
    LKIRLISDPNAELHKGLGAWGKKKRYGREYEGAIRSTFILSPKGEILWKKIKVKAKGHAKEVLEEAKRLISLENQI

    >gi|242399873|ref|YP_002995298.1| Thioredoxin peroxidase [Thermococcus sibiricus MM 739]
    MRKVKVGEKAPDFVLKDQDGKEFRLSGFRGKKVLLSFHPLAWTSVCEKQMRALEENYEKFESLNVVPVGISVDPIPTKKA
    WAEDIGLKKLRILSDFWPHGEVAKLYGIFREKEGFSERANILVDEEGKMIFFKMYPIRELPDLDEIFEFLQR

    >gi|242399876|ref|YP_002995301.1| Probable peroxiredoxin [Thermococcus sibiricus MM 739]
    MVAIGEKFPEVEVKTTHGAIKLPEYFAEKGKWFLLFSHPADFTPVCTTEFYALQKRVDKFRELGVEPIGLSVDQVFSHIK
    WMEWIKENLGEEITFPVIADDRGELADRLGMIPSGATTTARAVFVVDDRGIIRAIVYYPAEVGRDWDEILRLVKALKIST
    EKGVALPHKWPNNELIGDKVIVPPASTVDQVKKREEAKAKGEIECYDWWLCYKKLE