Thermococcus onnurineus NA1 uid59043

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|212223275|ref|YP_002306511.1| NADH:polysulfide oxidoreductase [Thermococcus onnurineus NA1]
    MKYDVVVIGASAGGLTAAISAKRFYPDKSVLVIKKEQTGMIPCGIPYIFGTFKSVDDDILPAEKFLEPLGVETLVDEVVE
    IDPKAKIVRTKSGKEIAWEKLVIATGSKPVFPELPGAELEDVYTVPKDYHYLKALRERLESAEKVVIVGGGFIALEVGDE
    IRKLGKDVTLLVRSRLLRSSFDPEFSEMVEGRLKEAGINIVYGQVERLLGSEKVEKVKLVDGNELDADLVIFSIGYRPNV
    DLAIKAGLKVTRYGIWTDEYMRTSHPDIFAVGDCVEHRDFFTGKPYGLMLASTATFEARIAGANLFRLQIVRENRRTIGV
    YSTHVAGLTLAAAGLTEEAARREGFEVIVGYGKGPDRHPAKFPDTSMVTVKLIFSRDRGAILGAQIAGGKSVGEMINILA
    LAIQKRLTASELYTLQIATHPLLTASPVGYQIVKAAEDALAKLRT

    >gi|212223350|ref|YP_002306586.1| NADH oxidase [Thermococcus onnurineus NA1]
    MNDLPMLNYDVVVIGGGPAGMAAAVRAKELGLKVLLLDDNDYLGGILPQCIHPGFGLHYFKEELTGPEFAARFAKRLVEL
    GVDYRTAARVLEIKNYSDLEKVVVFSSPSGAYQVWTKTIIYAAGARERHAFEIGIVGDRGAGIYTAGEAQTLMDIYGVML
    GKEIVIVGSGDVGLIMARRFALEGAKVKAVIELMPYPGGLARNIMILRDFDIPLYLSHKVVEVRGKERVERVKIVKVDEN
    LREIPGTEFWIEADTLIISAGLVPSVKLLTAIGVEIDPTTGGPVVNDLFETSVPGIFAAGNSVIINDLVDYVAEQGELAA
    EGAKLFIDNEGIPTRRWIKLEKGENVRLLVPHYLSGERDVWIYARVSKPMENVEVRFPEIGKKLRLPVVKPAEMLRMKLR
    KEEIAKARDGITMEVVPL

    >gi|212223451|ref|YP_002306687.1| NADH oxidase [Thermococcus onnurineus NA1]
    MKKTVVIIGGGAAGMSAASRIKRLKPEWDVKVFEATEWVSHAPCGVPYVVEGISPKEKLMHYPPEVFIKKRGIDLHMKAE
    VIEVEEGSVRVREEDGEHTYEWDYLVFANGASPHVPPIEGLELEGVFTADLPPDAVAIRDYIEKNKVENVVIIGTGYIAI
    EMAEAFVAQGKNVTLIGRSERVLRKTFDKEITDIVEEKLKAHLNLRLQELTMRIEGDGRVEKVVTDASEYPADLVIIATG
    IKPNTELAKQLGVRTGETGAIWTNEKMQTSVENVYAAGDVAETRHIITGRRVWIPLAPSGNKMGYVAGSNIAGKEITFPG
    VLGTSITKFLDLEIGKTGLTEAEAIKEGYDVRTAFIKAKTRPHYYPGAKEIHLKGVVDNETNRLLGVQAVGGEILPRIDA
    AAAMIQAGFTTKDVFFTDLAYAPPFAPVWDPLIVLARVLKF

    >gi|212223465|ref|YP_002306701.1| protein disulfide oxidoreductase [Thermococcus onnurineus NA1]
    MGLISDGDKKVIREEFFSKMTNPVKIIGFIGKDHCQYCDQLKQLVQELSELSDKLSYEFYDFDSEDGRKLAEQYGIDRAP
    AITITQDGKDMGVRFFGLPAGHEFGAFLEDIVDVSNAQTDLMPDTKEELAKVDRDVRILVFVTPT
    CPYCPLAVRMAHKFA
    IENTNAGKGKIRGDMVEAIEYPEWADQYSVMAVPKIVIQVDGEDKVQFEGAYPEKMFMEKLLAALE

    >gi|212223617|ref|YP_002306853.1| glutaredoxin-related protein [Thermococcus onnurineus NA1]
    MRRTALLLLFLLTVSLLSYAVAETQIDSNKVHFYMYGMSTCPHCQNMKKLIPEIYGPESLTYYELVNNEENQKLFGEQYK
    YTGIMGVPAVAITYNGTLYAIIEGEFNVSATPEIIEAAMENNGLILFVAGQAYIIKNETIIQKLQTIYVEHRLPEADTTE
    TSEITTSTPSEDETTSTSENNDKVCGPGIMAVLVIVPIVLLRRRR

    >gi|212223619|ref|YP_002306855.1| glutaredoxin/thioredoxin-like protein [Thermococcus onnurineus NA1]
    MDELEMIRRKKMLELMKRTGMIEVKSKGPKVVIEVITAPGCPYCPIAVQMARELERKYNGVVARELSVATPEGQRKAMEH
    NILGTPTILINNRVEFIGVPNFGEFERKVRMLLGLQ

    >gi|212223935|ref|YP_002307171.1| Hypothetical peroxiredoxin, bacterioferritin comigratory protein [Thermococcus onnurineus NA1]
    MSPLEVRVFSEDGKEVQLKDIVLGRWTVLYVYPKDNTPGCTTEAKEFTEILPEFEKLGFQVIGVSKDSVNSHRKFKEKHG
    LKIKLLSDPSAELIKALGAWGKKKRYGKEYEGVIRSTFILDPQGEIVWKKINVRAKGHAAKVLEEAKKLVKES

    >gi|212223978|ref|YP_002307214.1| peroxiredoxin [Thermococcus onnurineus NA1]
    MVVIGEKFPEVEVKTTHGVIKLPEYFAEKGKWFILFSHPADFTPVCTTEFYAMQKRAEEFRKLGVEPIGLSVDQVFSHIK
    WMEWIKDNLGVEIDFPIIADDRGELADKLGMIPSGSTITARAVFVVDDKGVIRAIVYYPAEVGRDWDEILRLVKALKTSD
    EHGVALPHKWPNNELIGDKVIIPPAATIEEKKKREEAKAKGEIECYDWWFCYKKLE

    >gi|212223983|ref|YP_002307219.1| hypothetical protein TON_0834 [Thermococcus onnurineus NA1]
    MIREFDGDFGKVERAKYALLWFSSPGCPPCRMIEPFMHELSEEYKEVEFWEVDVEKHLPLAEKFDVMNVPTLIYLKEGNE
    IARQNLVRKKEEVEEKLMMLLGSDS

    >gi|212223984|ref|YP_002307220.1| heavy-metal transporting P-type ATPase [Thermococcus onnurineus NA1]
    MKLTLKVNGMTCAMCVKTIETALKELDGVKDARANLNSENVYVDFDESRVSLNQIIKTIEELGYQVVREKRDAIIKIGGM
    T
    CAMCVKTIEVALKELPGVLDAQVNLATEKAKVSYDPSLVSIEDIKRAIEEVGYQFLGVEGEESHDVEKEIREKHMMEMK
    KKLAVAWGVGLTLFASMQLHRFGIEIPNLIYVQFLLATLAIIYAGRDIFGKALNSLKHKSLNMEVMYSMGIGSAYFASVL
    ATIGIIPREFNFYEASVLLMAFLLLGRYLETLAKGRTSEAIKKLMGLQAKKATVIRDGKEIEVPISEVKVGDIVIVKPGE
    RIPVDGIVIEGESYVDESMITGEPIPNLKNKGDEVIGGTINKNSVLKIEAKRVGRDTALAQIIRLVEEAQNTRPPIQRLA
    DKVVTYFIPAVLTIALISFGYWYFIADQPLLFAFTTLLSVLVIACPCAFGLATPTALTVGMGKGAEMGILIKNGEVLEIA
    RKATIVLFDKTGTLTKGTPEVTDVVTFGMDEKELLGLVASAEKRSEHPLGEAIVRKAQELGLEVKEPQSFEAITGKGIKA
    VVDGKEILAGNRKLFKENGYPIDREVEKALLKLEDEAKTAIIVAVDRKIAGVIGIADTIKEGAIEAIEELHKMGKKVGMI
    TGDNRRTAEAIARQLNIDYVLAEVLPQDKANEVKKLQEKGEVVIFVGDGINDAPALAQADIGIAVSSGTDIAMESGDIVL
    IKNDLRDVVRAIKLSQKTLSKIKQNIFWAMFYNTILIPFAAGLAYVLFGITFRPEWAAGAMSLSSVSVVTNSLLLKKAKI


    >gi|212223996|ref|YP_002307232.1| alkyl hydroperoxide reductase subunit c [Thermococcus onnurineus NA1]
    MVKVGEIVPDFETDAYLPEKDAIEKVKLSDYRGKWVVLAFYPADFTFVCPTELEELAEYYEEFKKEGAEILSVSTDTAYV
    HKAWHDTSPAIKKIKYPMLADPAGKICRLFGTYIEDEGVSWRATFIIDPDGKVVHMEMHDLSIGRSAKEILRRLRASKYV
    REHPGQVCPASWEPGKETLEVSLDLVGKI

    >gi|212224003|ref|YP_002307239.1| moeb [Thermococcus onnurineus NA1]
    MVDVKMDFSRHFPIIGMDGQRKLGESTVAVVGAGALGSWEVYFLHKLGVGRIIVVDRDFVDESDLPRTIYTSDDVGKPKV
    EVLKERFENVIGYFEDLNPSTVHLLDEADLIIDGTDNIYTRQVINDYAVKSNKPWIYVGILATYGNLMPIIPGKTACFRC
    LMPKLPSRPMPT
    CAVAGIMSYVPPLAASLAVTLAAKILLGGEVKSELIFFDTKTLDFEKVEIPRREDCEVCVRHNFTFLE
    KQMKIEHMCDGSIQITPPERMSIDLDELAKRLDALGIEYIKTSQFIQFEDDYAEILIFTSGRMIIRGAEDEKEAKNFFAR
    YLGG

    >gi|212224011|ref|YP_002307247.1| thioredoxin peroxidase [Thermococcus onnurineus NA1]
    MVKVGDVAPDFVLKDQNGEEFRLSDFRGRKVLLSFHPLAWTSICERQMKALEEHYDELEELNVVPVGISVDPVPTKKAWA
    DHMGLKKLRMLADFWPHGEVARKYGLFREKDGISERANVIIDENGRVAFVKIYPLGELPNLNEILAVLKG

    >gi|212224420|ref|YP_002307656.1| NADH oxidase [Thermococcus onnurineus NA1]
    MKIVVIGSGTAGSNFALFMRKLDRKAEITVIGKEETMQYSPCALPHVISGTIEKPEDVIVFPNEFYEKQKITLMLGTEAK
    AIDRERKVVITDKGKVSYDKLVLAVGSKTFVPPIKGVENEGVFTLKSLDDVRKIKAYIAERKPKKAVVIGAGLIGLEGAE
    AFAKLGMEVLVVELLDRLLPTMLDKDTAKLVQTEMEKHGVSFRFGVGVSEIIGSPVKAVKIGDEEVEADLVLVATGVRAN
    VDLAKKAGLEVNRGIVVNEHLQTSDPDIYAIGDCAEVIDAVTGGRILSQLGTSAVRMAKVAAEHIAGKDVSFRPVFNTAI
    TELFGLEIGTFGITEDRAKKEGIAIAVGKFKGSTKPEYYPGGKPITVKVIFRKDDRKLIGAQIVGGERVWGRIMTLSALA
    QKGATVEDVVYLETAYAPPISPTIDPISVAAEMALRKFK

    >gi|212224618|ref|YP_002307854.1| methylated-DNA--protein-cysteine methyltransferase [Thermococcus onnurineus NA1]
    MLSVERFDIARKEVWIAVIFDEKIQGITFSLDGEGFLRERIANMAFFLKKRGVNVELTLLESDYPRLVRDVILGKLENEE
    LLPELGFLGVTSFERRVYEWLTKRVKRGSVVTYGELAKTLGTSPRAIGGAMKRNPYPIVVP
    CHRVVAWDGPGYYTPKLEY
    KAFLLKLEGVEEWTSSKRT

    >gi|212224624|ref|YP_002307860.1| carboxymuconolactone decarboxylase-related protein [Thermococcus onnurineus NA1]
    MDCEDVQVKLKEIGELLDKLGKEHPKEISAFSRFLREVVDNKALTTREKELIALALGIAQGCEWCIYLHTQKALEAGAKK
    EELIEAGLVAVLMAGGPALMHLIPLMKAIETFEKEHGTE

    >gi|212224754|ref|YP_002307990.1| thioredoxin reductase [Thermococcus onnurineus NA1]
    MFSLGGFSRGGEYEKKAWDVLIIGAGPAGFTAAIYAARFGLETLIISKDLGGNMALTDLIENYPGFPEGISGSELTTRMH
    EHVKKLGVDIVFDEVERIDPTECAYYEGPCKFVVRTKNGKEYKGKTIIIAVGAAPRKLNVPGEAEFTGRGVSY
    CATCDGP
    LFKGKKVIVVGGGNTALQEALYLKSIGVDVTLVHRRDQFRADKILQDRFKASGIPMILNTVVTEIKGTNKVEAVKLKNVK
    TGEETEMAVDGVFIFIGYEPKTDFVKHLGITDEYGYIPVDMHMRTKVKGIFAAGDITNVFKQIAVAVGQGAIAANSAKEL
    LEEWGEKNGE

    >gi|212224960|ref|YP_002308196.1| hypothetical protein TON_1809 [Thermococcus onnurineus NA1]
    MPEYKDLEIKAVGERLSPTKMRVRAEGFEILIDKLGGEYPCPLDYQLAALAGCLNIVGTLVAKDMGINIESLTVEVKGIF
    NPEKFMTGNGGRAGFKEISVKIKVKADADEEKLKEWIEKVDER
    CPISDNLLNLTPLKIEVEKA

    >gi|212224652|ref|YP_002307888.1| Hypothetical oxidoreductase [Thermococcus onnurineus NA1]
    MRAVVIGSGIGGLLTASFLAKNGYEVTLLEKAPYIGGRCTNLNYKGFGLSTGAFHMIPHGEDGPLAHLLKLLGADVQIVN
    SNPKGMIFYEGRTFSYRDGWKYLSLTEKAKATKLLLDIKRGKLPHREEAEMSGREWIRERVGDNEFVDLFIKSFLGWADS
    VLDVPAIELAKEIKAALRWGGPGLVKGGCKSIPEALSAIIRMNGGRILTKKKAIEVDHEAKKVITADNEELTYDVLISNV
    GIKETVSLIGRDAFDKDYLKRVDSLKPSEGIKYNVALKGETRIGNTVVFTLDTERINGYNEPSSINPELAKDGHTLIMLH
    HALQSRNVKAEQKKGIEDIHRIFPNLDKEGEILLVQTYLGGNPVNRVASGQLVEDFPIRDIYVVGDAYKMPGGIEVDGIA
    LGVMRTLEKLGLESFSEWYL