Thermococcus kodakarensis KOD1 uid58225

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|57640239|ref|YP_182717.1| NADH oxidase [Thermococcus kodakarensis KOD1]
    MKIVVVGSGTAGSNFALFMRKLDRKAEITVIGKEPTMQYSPCALPHVVSGTIEKPEDIIVFPNEFYEKQKINLMLNTEAK
    AIDRERKVVVTDKGEVPYDKLVLAVGSKAFIPPIKGVENEGVFTLKSLDDVRRIKAYIAERKPKKAVVIGAGLIGLEGAE
    AFAKLGMEVLIVELMDRLMPTMLDKDTAKLVQAEMEKYGVSFRFGVGVSEIIGSPVRAVKIGDEEVPADLVLVATGVRAN
    TDLAKQAGLEVNRGIVVNEHLQTSDPEVYAIGDCAEVIDAVTGKRTLSQLGTSAVRMAKVAAEHIAGKDVSFRPVFNTAI
    TELFGLEIGTFGITEERAKKEDIEVAVGKFKGSTKPEYYPGGKPITVKLIFRKSDRKLIGGQIVGGERVWGRIMTLSALA
    QKGATVEDVAYLETAYAPPISPTIDPITVAAEMAQRKLR

    >gi|57640472|ref|YP_182950.1| peroxiredoxin [Thermococcus kodakarensis KOD1]
    MVVIGEKFPEVEVKTTHGVIKLPDYFAEQGKWFVLFSHPADFTPVCTTEFYAMQKRVDQFRELGVEPIGLSVDQVFSHIK
    WMEWIKENLGEEITFPVIADDRGELADKLGMIPSGATITARAVFIVDDKGIIRAIVYYPAEVGRDWDEILRLVKALKVSD
    EKGVALPHKWPNNELIGDKAIVPPASTVDEVKQREEAKAKGEIECYDWWFCYKKLE

    >gi|57640750|ref|YP_183228.1| AhpC/TSA family peroxiredoxin [Thermococcus kodakarensis KOD1]
    MKVGETALDFVLKDQDGKEFRLSDFRGKRVLLSFHPLAWTGICEKQMKALEENYERFEELNVVPVGISVDPVPSKKAWAE
    HMGLKRLRILSDFWPHGAVSKLYGIFREDGGFSERANVLVDEEGRVVFFKVYPISELPDLEEIFEVLH

    >gi|57640754|ref|YP_183232.1| bifunctional methionine sulfoxide reductase A/B protein [Thermococcus kodakarensis KOD1]
    MGGIKIEPKTAIFAGGCFWCMEEAFERLPGVIEAISGYTGGWVENPTYELVSTGETGHREAVKVIYDPSKISYERLLDVF
    WRNIDPTDPGGQFADRGEQYKTAIFYLDEEQRELAEESKRRLELSGIFDEPIATEILPAKEFYPAEDYHQGYYFRFEANY
    KGYKLYSGRLGFIKSVWEKNRHFRLFPEREGYWLGYVKPSDAELKRQLTPLQYRVTQLGDTEEPFHNEYWNNHEEGIYVD
    VVSGEPLFSLLDKYDSGTGWPSFTKPLEEWAVVEAGECEGFLCGREVRSRFAGSHLGHVFDEPTPTGKRY
    CINSAALRFI
    PRDELRRYGYTAYEGIFK

    >gi|57640772|ref|YP_183250.1| heavy-metal transporting P-type ATPase [Thermococcus kodakarensis KOD1]
    MKTTLKVNGMTCAMCVKTIEMALAGLEGVKAAKANLNSETVFVDFDESKVSINQIIRAIEDVGYEVIRERRDAVIKIGGM
    T
    CAMCVKTVENAIRELPGVLDVSVNLATESARVSYNPALVTIEDIKGAVEGVGYEFLGVEGEESHDIEKEVRERHIKEMK
    RSLLVAWGIGIPLFLSMQLKRLGIEVENLIYVQFLLATVAIAYAGRGIFKKAYSSLRHMTLNMEVMYAMGIGSAYLTSVL
    ATLGVIPREFNFYEASVLLMAFLLLGRYLEARAKGRTSEAIKKLMGLQAKKATVVRDGKEIEVPISEVKVGDIVVVRPGE
    RIPVDGTVIEGESYVDESMITGEPIPVLKKSGEKVIGGTINRNSVLKVRAEKVGRDTLLAQIIKLVEEAQNTKPPVQRLA
    DTVVTYFIPAVLTIALLSFTYWYFIAGKPLVFAFTAFLSVLVIACPCAFGLATPTALTVGVGKGAELGILIKNGEALEIA
    RKATVVLFDKTGTLTKGKPEVTDVITFDVDEGEFLELVASAEKRSEHPLGEAIVRKAEELGIEVEEPEEFEAVTGKGVRA
    KVRGKEVLAGNRRLMVENGIDLESVEETLQRLESEGKTAIVVAMDGKIVGIIAIADTIKKGAREAIEDLHRMGKKVGMIT
    GDNRRTAEAIGKALGVDYILAEVLPGDKANEVKKLQEKGKVVVFVGDGINDAPAMAQADVGIAVGNATDIVMESGEVVLV
    RNDPRDVVRAIKLSQKTISKIKQNIFWAMFYNTILIPFAAGLAYVLFGVTFRPEWAAGAMSLSSVSVVTNSLMLKRVRV

    >gi|57640773|ref|YP_183251.1| thioredoxin [Thermococcus kodakarensis KOD1]
    MIVEYDENVDFTKGKAVLWFSIPGCPPCRLVEAFMKELSEEFGEIAIVHVNAEKWSGLVEGFRILNVPTLVYLKDGKEVA
    RQNLIRGKGEVLIKFEEPREL

    >gi|57640990|ref|YP_183468.1| peroxiredoxin bacterioferritin comigratory protein [Thermococcus kodakarensis KOD1]
    MNYLEIKVLDENGEGKPLKDFVLGRWTVLYFYPKDNTPGCTTEAKEFSELIEEFEKLGVQVIGVSRDSPGSHRKFREKHN
    LKVKLLSDPNAELHKALGAWGKKKRYGKEYEGAIRSTFILNPEGEIVWKKINVRAKGHAAKVLEEVKKLIGSEE

    >gi|57641020|ref|YP_183498.1| protein disulfide oxidoreductase [Thermococcus kodakarensis KOD1]
    MGLISDADKKVIKEEFFSKMTNPVKLIVFVGKEHCQYCDQLKQLVQELSELTDKLSYEVVDFDTEEGKKLAEQYRIDRAP
    ATTITQDGKDMGVRYFGLPAGHEFGAFLEDIVDVSNGTTDLAPDTKEAIHGVDKDVRILVFVTPT
    CPYCPLAVRMAHKFA
    IENTLAGKGKILGDMVEAIEYPEWADQYSVMAVPKIVIQVDGEDKVQFEGAYPEKMFLEKLLAALE

    >gi|57641143|ref|YP_183621.1| glutaredoxin-related protein [Thermococcus kodakarensis KOD1]
    MKKTGILLMLLVLVGFASACLSSDSNTSSQTSTESPKYVDVNGTRIYLDQIHFYMYGMKTCPHCRHMKEWIPEEFGADSL
    TYYELVNDETNSELFGQLAQLTGITGVPAIAITYNGTIQAIFEGEFNVSATPEIVATAMNANGVILFIGGEWYLLARDNP
    RSETLIDALQTIFVEHESVDVQSVLTKLKSNSTG

    >gi|57641234|ref|YP_183712.1| NADH oxidase [Thermococcus kodakarensis KOD1]
    MERKTVVVIGGGAAGMSTASRVKRLKPEWDVKVFEATEWVSHAPCGIPYVVEGISPKEKLMHYPPEVFIKKRGIDLHLKA
    EVIEVEQGRVRVREEDGEKTYEWDYLVFANGASPQVPAIEGIDLPGVFTADLPPDAVAITEYLEKNPVENVVVIGTGYIA
    IEMAEAFVERGKNVTLIGRSERVLRKTFDKEITDIVEEKLRNHLNLRLEEVTLRIEGKERVERVVTDAGEYPADLVIVAT
    GIKPNTELARGLGVRIGETGAIWTNDRMQTSVENVYAAGDVAETKHLITGRRVWMPLAPAGNKMGYVAGSNIAGKEIHFP
    GVLGTSITKFLDLEIGKTGLTEAEAMKEGYDVRTAFIKAGTRPHYYPGSKTIWLKGVVDNETNRLLGVQAVGGDILPRID
    TAAAMITAGFTTKDVFFTDLAYAPPFAPVWDPLIVLARVLKF

    >gi|57641327|ref|YP_183805.1| NADH oxidase [Thermococcus kodakarensis KOD1]
    MLSYDVVVIGGGPAGMAAAAKAKELGLNVLLLDENDYLGGILPQCIHPGFGLHYFKEELTGPEFASRLAKRLVELGVEYR
    TAARVLEIKNYSDLEKVVIFTSPAGVYQVWAKAIIYAAGARERHAFEIGIVGDRVAGIYTAGEAQTLMDIYGVLPGKEVV
    IVGSGDVGLIMARRFALEGAKVKAVVELMPYPGGLARNVMILRDFNIPLYLSHKVVEVRGKGRVQRVRVVKVDENFNEIP
    GSEFWIEVDTLVISAGLIPSVKKLKKIGVEIDPATGGPVVNDRLETSVPGIFVAGNSLLINDLVDYVAEQGELAAKSAKE
    FIENGGIESRKWVKVEKGQNVRLIAPHYLGGDRDVYLYLRVARPMENVELRIPEIGKKLRLPVVKPAEMIRLKLRAEEIQ
    KASERLTVEVVRA

    >gi|57641416|ref|YP_183894.1| NADH:polysulfide oxidoreductase [Thermococcus kodakarensis KOD1]
    MKYDVVVIGGSAGGLTAAISAKRFYPDKSVLVIKKEDVSMIPCGIPYIFGTLRSVEDDVLPTERFLKPLGIDVLVDEVTE
    INPKSKTLLTKSGREIGWEKLVLATGSRPQIPDIPGVELEGVYTVSKDYHYLKELKKRVEDAEKVVIIGGGFIALEVGDE
    IRKLGKDVTIVVRSRLLRNSFDPEFSEMIENRLKEVGINVVYGHVERLVGRERVEGVKLVEGGEIPADLVILSTGYRPNV
    ELAVKTGLKVTRYGIWTDEYMRTSCPDIFAVGDCVEHRDFFTGKPFPLMLASTATFEARIAGANLFKLQIVRENRRTIGA
    YSTHVAGLTLAAAGLTEEAAKREGFEVIVGRATGPDRHPAKFEDTSMVTVKLIFSRDRGAILGAQLAGGKSVGEMINVLA
    LAIQKRLTASELYTLQIATHPLLTASPVGYQILQAAEDALAKLRAGA

    >gi|57641906|ref|YP_184384.1| methylated-DNA--protein-cysteine methyltransferase [Thermococcus kodakarensis KOD1]
    MLSVEKFRVGERVVWIGVIFSGRVQGIAFAFDRGTLMKRIHDLAEHLGKRGVSISLDVQPSDYPEKVFKVLIGELDNASF
    LRELSFEGVTPFEKKVYEWLTKNVKRGSVITYGDLAKALNTSPRAVGGAMKRNPYPIVVP
    CHRVVAHDGIGYYSSGIEEK
    KFLLEIEGVKEWTS

    >gi|57641909|ref|YP_184387.1| carboxymuconolactone decarboxylase-related protein [Thermococcus kodakarensis KOD1]
    MENGDVMVKLKEIEELLEKLGKEHPKEIAAFSRFLRETLDNKALTTREKELIALALGIAAGCEWCIYLHTQKALEAGAKP
    EELIEAGLVAVLMAGGPALMHLIPLVKAIESFQKEHGE

    >gi|57642035|ref|YP_184513.1| thioredoxin reductase [Thermococcus kodakarensis KOD1]
    MFSLGGFSRGGEYEKKTWDVLIIGAGPAGFTAAIYAARYGLETLIISKDLGGNMALTDLIENYPGFPEGISGSELTNRMH
    EQVKKLGVDVIFDEVVRIDPAECAYYEGPCKFTVKTANGKEYKARTIIIAVGAAPRKLRVPGEEELTGKGVSY
    CATCDGP
    LFKGKKVIVVGGGNTALQEALYLKSIGVDVTLVHRRQQFRADKILQDRFKESGIPAILDTVVTEIIGKDKVEAVRLKNVK
    TGEETVMEVDGVFIFIGYEPKTDFVKHLGITDEYGYIPVDMYMRTKVPGIFAAGDITNVFKQIAVAVGQGAIAANSAKEF
    LEEWKNKNSE

    >gi|57641952|ref|YP_184430.1| OsmC/Ohr family stress-inducible protein [Thermococcus kodakarensis KOD1]
    MKRLEYSAHLKWDGNVGSEAKVREFTFHIDTNTDGHNKGPNPTEYLLAAIGGCLTVNWGRLIKKMRLDVKGFEVEVRGWR
    GLDEPQLKEITYKITVFTNEDEKKIMRVKELAEKYGTVFNTVGAEKIKGEVEIIKPADP