Thermococcus gammatolerans EJ3 uid59389

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|240102238|ref|YP_002958546.1| Thioredoxin reductase (trxB) [Thermococcus gammatolerans EJ3]
    MGEMFSLGGFSRGGEYEKKLWDVLIIGAGPAGFTAAIYAARFGLETLILSKDLGGNMALTDLIENYPGFPEGISGSELTA
    RMHEHVKRLGVDIVFDEVERIDPAECAYYEGPCKFTVKTKNGKEYRAKTIIIAVGAAPRKLKVPGEEELTGKGVSY
    CATC
    DGPLFKGKKVIVVGGGNTALQEALYLKSIGVDVTLVHRRQKFRADKILQDRFRESGIPAILDTVVTEIIGKDKVEAVRLK
    NVKTGEEKEMKVDGVFIFIGYEPKTDFVKHLGITDDYGYIPVDMHMRTKVPGIFAAGDITNVFKQIAVAVGQGAIAANSA
    KEFLEKWAEKNGE

    >gi|240102382|ref|YP_002958691.1| methylated-DNA--protein-cysteine methyltransferase [Thermococcus gammatolerans EJ3]
    MLAVERFGVNGRDIWIGVIFHGRIQGISFAFTRGELLERIRNLAEFLRGRDVRVSLDVQPSNYTELVYRVLIGELENEKA
    LPELSFEGVTPFERRVYEWLTKNVKRGTVITYGSLAKALETSPRAVGGAMKRNPYPIIVP
    CHRVVSREGIGHYNLGIEEK
    KFLLELEGVKEWTG

    >gi|240102421|ref|YP_002958730.1| NADH oxidase (NOXase) (nox) [Thermococcus gammatolerans EJ3]
    MKIVVIGSGTAGSNFALFMRKLDRKAEIVVIGKEGTMQYSPCALPHVISGTIEKPEDVIVFPNEFYERQKIELMLNTEAK
    AIDRERKVVITDKGEVPYDKLVLAVGSKAFIPPIKGVENEGVFTLKSLDDVRRIKAYIADRKPKKAVVIGAGLIGLEGAE
    AFAKLGIEVLVVELMDRLMPTMLDKDTAKLVQKEMEANGVSFRFGVGVSEIIGSPVEAVRIGDEEVPAELVLVATGVRAN
    TDLAKEAGLEVNRGIVVNEHLQTSDPDIYAIGDCAEVIDAVTGERTLSQLGTSAVRMAKVAAEHIAGKDVSFRPVFNTAI
    TELFGLEIGTFGITEERAKKEGIEVAVGKFKGSTKPEYYPGGKPITVKLIFRKSDRKLVGAQIVGGERVWGRIMTLSALA
    QKGATVEDVVYLETAYAPPISPTIDPITVAGEMALRKLR

    >gi|240102473|ref|YP_002958782.1| Stress reponse protein, putative, OsmC-like protein [Thermococcus gammatolerans EJ3]
    MAKMPKYKDMPVKISGIRVSPTKMKVVGNGFEIVVDKLGGEAPSPLHYQLAALAGCLNIVGTLVAKDLKIDVEGMEVEIV
    GIFNPSKFMGVDNGRAGFKEIDVTIRVKTDADEETLKKWLSLVEERCPISDNLANPTPVRIEIERE

    >gi|240103081|ref|YP_002959390.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Thermococcus gammatolerans EJ3]
    MKDVVVIGGGPSGMAAAVKLAGKGYDVALIERKEELGGILDQCIHDGFGTKIFGKALSGPEFAGHFMDEVSKLGLDVHLN
    TYVKSVNAGGDVKELVTVSPRGVERIKARSIVYAIGCRERHPFEIKVGGTRPAGVYTAGMVQRLVNLYGILPGRRVLIVG
    GGDVGMIVARHLYLEGVESITVVFPEEFFVGLPRNVQQCILDFNIPFRPRTVVKEMVGKERVEGAILVKVDENWRPIPGT
    EEFYPCDTVIFSVGLVPYAKKLRAIGAEIDPRTRGPVVNEFFETTVRGVFAAGNLVQIFDYVDDAVESAYIAADGVEKYL
    KGEKRLDNPVPFKPGSNVRTLTPHRLEWKDERPVVAFLRPAVEGRAWIIVRGGNGEILKKEFRQYVRPSTLERIEIPREA
    ISGAEEVYVDVARV

    >gi|240103107|ref|YP_002959416.1| NAD(P)H sulfur oxidoreductase [Thermococcus gammatolerans EJ3]
    MGKKVVIIGGGAAGMSTASRVKRLKPEWDVKVFEATEWVSHAPCGIPYVVEGISPTEKLMHYPPEVFIKKRGIDLHLKAE
    VIEVGQGYVRVREGDGEKSYEWDYLVFANGASPRIPAVEGVTLPGVFKADLPPDAVAIKEYIEKNRVEDVVIIGGGYIGV
    EMAEAFSAQGKNVTLIERNERVMSKAFDREITDVLEEEMRKRIDLRTQEIVLKIEGSERVEKVITDAGEYKADLVILATG
    IKPNVELAKEIGVRIGETGAIWTNEKMQTSVENVYAAGDVAETRHLITGRRVWIPLAPAGNKMGYVAGSNIAGKELHFPG
    VLGTSVTKFFDVEIGKTGLTEAEAIREGYDVRTAFIKATTRPHYYPGAKPIWLKGVVDNETNRLLGVQAVGAEILPRIDT
    AAAMLTAGFTTKDAFFTDLAYAPPFAPVWDPLVVLARVLKF

    >gi|240103277|ref|YP_002959586.1| Peroxiredoxin, bacterioferritin comigratory protein-like protein (bcp) [Thermococcus gammatolerans EJ3]
    MNYLNIAVFDEDGTEKPLKDLVLGRWTVLYFYPKDNTPGCTTEAREFTELIDEFEKLGFQVIGVSRDLPKSHARFKEKHN
    LKVRLISDPNAELHRALGVWGKKKRYGREYEGAIRSTFILDPNGKIVWEKRNVRAKGHAAKVLEVAKGLIGKE

    >gi|240103310|ref|YP_002959619.1| peroxiredoxin [Thermococcus gammatolerans EJ3]
    MVVIGEKFPEVEVKTTHGVIKLPDYFAEQGKWFILFSHPADFTPVCTTEFYAMQKRLDKFRELGVEPIGLSVDQVFSHIK
    WMEWIKENLGVEIEFPIIADDRGELAEKLGMIPSGATITARAVFVVDDKGVIRAIVYYPAEVGRDWDEILRLVKALKISD
    ENGVALPHKWPENELIGDKVIIPPASNIEEKKQREEAKAKGEIECYDWWFCYKKLE

    >gi|240103359|ref|YP_002959668.1| Glutaredoxin-like protein [Thermococcus gammatolerans EJ3]
    MGLISDADKKIIKEEFFSKMTNPVKIIGFTGKEHCQYCDQLKQLVQELSELTDKLTYEFYDFDTEEGRKVAEQYRIDRAP
    AVTITHDGKDVGVRFFGLPAGHEFSAFLEDIVDVSNMTTDLMPESKEALAKIDRDVRILVFVTPT
    CPYCPLAVRMAHKFA
    IENTNAGKGRILGDMVEAIEYPEWADQYSVMAVPKIVIQVDGEDKVQFEGAYPEKMFMEKLLAALE

    >gi|240103693|ref|YP_002960002.1| Glutaredoxin related protein [Thermococcus gammatolerans EJ3]
    MAGMKRVVGLALLLLLSSVLFPVSASDWKFDPSLVHFYLYGAKTCPHCRHMKEVIPETYGADKFTYYELVGNSHNDEVLN
    NISRLIGVTGVPVIGITYNGTLVAVIEGEYKVSATPEIVETALKNNGTLLLLASGNYILPHNNTKAREIVEKLQYLFTKA
    GEPSETSTTPKKTHTTASETPADGTHTTTNGNDKRICGPALIIAIAMVPLFPRRRR

    >gi|240103849|ref|YP_002960158.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Thermococcus gammatolerans EJ3]
    MFPEIPMLSYDVVVVGGGPAGMAAAIRAKELGLKVLLLDENDYLGGILPQCIHPGFGLHYYREELTGPEFASRLAKRLVE
    LGVEYRTAARVLEIKNYSDLEKVVIFTSPSGAYQVWAKAVIYAAGARERHAFEIGIVGDRVSGIYTAGEAQTLMDLYGIM
    PGKEIVIVGSGDVGLIMARRFALEGAKVKAVVELMPYPGGLARNVMILKDFNIPLYLSHKVVEVRGKGRVERVKVVRVDE
    NLNEIPGSEFWIEADTLIISAGLVPSVKKLKKIGVEIDPATGGPVVNDRLETSVPGIFVAGNSLLINDLVDYVAEQGELA
    AEGAKEFIENGGIESRKWVKVEKGENVRLIAPHYLSGDRDVYLYLRVSKPMEDVELRIPEIGKRMKLPVVKPAEMLRIKL
    KAEEIRKAERLTVEVVKA