Sulfolobus tokodaii 7 uid57807

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|15920408|ref|NP_376077.1| redoxin-like protein [Sulfolobus tokodaii str. 7]
    MEEEFAELFTDEVKQALVDALKDMKNPVDIYVFIDSNDPHCHYCEVTKRFLQFMSDAAPKDSEGKSLAVVHVIDRADPNS
    AEIFKEFRVERVPTVAFMKGYLRWTGAPLGEEIRALVETVVRLSLGESGLSAETINAIKNKLNGYVKIETVVTPS
    CPYCP
    YAALMAHMVAYEACKAGKCNVESDVVEAYENQDIAEKYQVMSVPTVAINESVEFIGVPYEENFINSLLEKQKL

    >gi|15920649|ref|NP_376318.1| thioredoxin reductase [Sulfolobus tokodaii str. 7]
    MQQLNQHNEIYDVIIVGAGIAGLSAALYTSRQRMKTLVVSKDLGGQLTLTDLIENYPVVEPLSGLSLARKVESQAKRFGA
    KFIYGEEIYKIDKKGDIFELQGILGSYKAKTVILAFGKTPRELNVPGEKEFKGKGVSY
    CAICDAAFFKDKPAAVVGEGEP
    GVEAIELLSKYARPAYYISMSTQLVGGDEGTLKSILNNENIKMFLGYKVIRIIGNSKVEGIVIQNSKTKEDKILNVDGVI
    IEMGYVLRTEFLKDFIKLNEKGEIIVDELGRTNVEGIFAAGDVTNTPYKQAVVAAAEGVKAALSAYNYLRSKSGLPPVNV
    DWKAEKQKAVVSFRL

    >gi|15920765|ref|NP_376434.1| thioredoxin reductase [Sulfolobus tokodaii str. 7]
    MMSLLPRAFDVRPGEKFDVVIIGMGPAAYSAALYSARFMLKTLMIGETPGGQLTEAGEVDDYLGLIGIQAADMIKLFNKH
    IEKYNVPAIMDTVEYFRKENNEFIVKTKRRGEFKADAIIVAVGVKRRKLNVPGEAEFTGKGVSY
    CSVCDAPLFKNRPVVV
    VGGGDSALEGAEILSRYATKVYLVHRRDEFKAQPIYVESVKQKPNVEFILNSVVKEIKGDKIVRKVIVQNLKTNEIRELD
    VNGVFVEIGFDPPTDFARQNGLEVDSHGYIKVDEWMRTNIEGVYAAGDCTGMWLGFRQIITSAAQGAVAAHSAFNYLTEK
    KRKK

    >gi|15920801|ref|NP_376470.1| putative peroxiredoxin [Sulfolobus tokodaii str. 7]
    MVKLYSKFPDVQVLTTKGPIDFYKDIFGKGKWLFLFAHPADFTPVCTTEFVAFSQKYEEFKKLGVELVGLSVDSIYSHIQ
    WLMDIEQRYGVKVPFPVIADPDKKLARMLDALDEASGQTIRIVVLASPDGIIRFVAQYPMEFGRNIDELLRITKAAIVNY
    KAKVVLPANWQPGQDVIVPPPAIFDEAEMRIKLPNAKAWYLLFKKYEELPPDQKV

    >gi|15920833|ref|NP_376502.1| hypothetical protein ST0613 [Sulfolobus tokodaii str. 7]
    MEVNEQYVSPFYPHIIDAFPSIVRKLWKKNQVLLLDIRTPMEYEDHHIPGALLVPLDYLDVLLHKIQHKEVAVICEHGNR
    ARYATYGMPELWKGKKVYYMIGGMAGWMQMGYEVTSGMDENGKLWEKWIEELQ

    >gi|15920912|ref|NP_376581.1| dihydrolipoamide dehydrogenase [Sulfolobus tokodaii str. 7]
    MKYDVTVIGAGGGGYPGAFRLAKSGYNVLMADPKGELGGNCLYSGCVPSKTVREMAQLIWRTSRVLKQEIKVNFERIQAH
    KDFVQETRFKQHKRELSEYNSITFYKGVIKIKDPNHVIVKTEDKEIEAETRYIIIASGSEPFKPQFPGSEY
    CITSDDLYS
    YKTPLRKLPQDMVIIGGGYIAIETASIFNILGVKTHLLVRGDRVLRGFEDEIVNTLLPILKLDIIYNAPVLEIKKIKEDE
    FEVIYSSKDGAKKSIRTNLVLLATGRKPVLPEGIENTGIALDKRGYIVVDNAMRTNLPNVFATGDVNGKAPYFHAAVRMS
    IAAAYNIMANGSPIDYVDYKSIPVTIYSVPSASYVGIMPSEAKRMGIEIMEATYNMEDEVMAQMYDEREGMLKLIFEKGS
    LRLIGAWMVGVHSQYLINELGQAVLHGLTAKQLASFADQHPSTNEIIAYAARKVL

    >gi|15920951|ref|NP_376620.1| bacterioferritin comigratory protein [Sulfolobus tokodaii str. 7]
    MKVGDKAPLFEGITDTGEKFSLADYIGKYNIVLYFYPKDDTPGCTREACAFRDNWNLLQGYDVVVIGISSDDVESHKKFK
    QKYNLPFILVSDPDKKIRELYGAKGFILPARITFVIDKKGIIRHIYNSQLNPENHVKEALKTLEMLKKEEESVS

    >gi|15921061|ref|NP_376730.1| hypothetical protein ST0827 [Sulfolobus tokodaii str. 7]
    MIKLTFFHDVICPFCFVMSKRLKNVVREFKGEVIVKHKAFSIISSLEDLKEIAPTIEDARKVFLSEFQIVKKYFPDYDPE
    KVISKGKIGYVWSIPPLMACKAAEFQKGDEGHWEYFDKAQDKFFLEGEDVTQDEVLIKIAEEVGLDVEQFKRDFKSKKAK
    LAVIEDEEEAKAMGIHGVPAILINDVWLVRGVQSEDFLRQTIEDILEHGEPKNVKLKAFWERE

    >gi|15921118|ref|NP_376787.1| hypothetical protein ST0882 [Sulfolobus tokodaii str. 7]
    MPPSMVLQPVYQESWALIYGLFGLSGFILGWVAQRGNYCFVNAMTSIFTTRSFERFGALLILFGLSALGCGLLVAFGIIP
    AVDQYYFNYFAGWYILVGSFVFGFGAALAGG
    CNLSMLYRAASGYVQNWIELFGMMIGTYIFAIGIWPFQQYTMEKGIFST
    TLGGYVEYLPYVIFHSVSPMAVYITTLILSLPLIILGIYLQQYTKKKWNMNFRMSTPGIMAYKPPAPISVGKEGEEKKDW
    KKEALDMLLLKKPYGTNLSTVILALDMIFVFIVGAGYTFNYLVITSSDGGRFFEYLLMIPGINLFLNTPWFNDSLPIVDP
    STLMVVMLCIGAFAASFLSGDFKIRIPKEKKRLLIGFLGGMLVGIGVRMALG
    CNVGLMWTNFAQLGYDGIIFLFGMLGGV
    WLAVKVQERL

    >gi|15921208|ref|NP_376877.1| methylated-DNA--protein-cysteine methyltransferase [Sulfolobus tokodaii str. 7]
    MIVYGLYKSPFGPITVAKNEKGFVMLDFCDCAERSSLDNDYFTDFFYKLDLYFEGKKVDLTEPVDFKPFNEFRIRVFKEV
    MRIKWGEVRTYKQVADAVKTSPRAVGTALSKNNVLLIIP
    CHRVIGEKSLGGYSRGVELKRKLLELEGIDVAKFIEK

    >gi|15921327|ref|NP_376996.1| mercuric reductase [Sulfolobus tokodaii str. 7]
    MTEMRLVIVGNGAAAFAALIRANELGVKPVMISHGIIGGTCVNVGCVPSKRMLRIGEVYDYTRKTLGKDVYPDFFKAFED
    KQEIVETLRKEKYIDVLSSYDVEYVEGKAHFVSPKEVKVNGKIIEGDKFIIATGSSPQIPDIPGLKELGYWTNVEALSPN
    RKISSLAVIGGRALALEFAQMYKRLGVDVLILQRSKIIIPNWEPEISIAVQNYLSKEEGIYIVTDVKIKEIKKGDEGGKI
    IVTDKGEAEVDEILVATGRRPNVDLNLDVAGVKLNEKGGILVNETLQTTNPNIYAAGDVIGDLMLESLAGKEGSVAAENA
    ILNSGKKIDRLSIPQVIFIEPNVARVGLTYLEAQREYSVESRVVKMSSVAKARILREPQGLIKMNVDKNTKKILGVQMFG
    KYAAEVINEAALAIRLRATIDDIIDTVHVFPTMAESLKLAAMSFYRDVDKMSCCVD

    >gi|15921676|ref|NP_377345.1| thioredoxin [Sulfolobus tokodaii str. 7]
    MFVDCWAPWCAPCHIYEPIFNKMAEKYKDKIVFGRLNVDENPKTADKYGVMNIPTTLIFLNGNLVDQIVGAVDETTLEEY
    IKKYLS

    >gi|15921780|ref|NP_377449.1| dihydrolipoamide dehydrogenase [Sulfolobus tokodaii str. 7]
    MHYDVIIIGGGVGGLAAAIRSAELGKKVAIIEKNEIGGECINRACIPSKTLIDTAKIVNKILKSPWIATSAKINYNLMNK
    FKDDIIEGIKDNLYQVINKHKIDLLSGKGEVKNEGEVIVNGKVYTYENLVIATGSEPLSLADFPLNGKNVVDPWTAMNMT
    NLPENIIIVGGGVAGVELATLFRALNKNVTIIELMPRLLPVPGIDIEIANEVKKRLEEKGVRIYVNTKSRIIKSDDKVIF
    QAQTPSSNEEISGDLAVITIGRKPVTDGIDLKAIKVETDQRGYIKVDNRARTSNSKVYAVGDVAGAPLSATKAWRQGIVA
    GDNIGNRNSQMPKYIPTSIFADLEIGVVGSTLEELKKNGINGREVKVNMKEIPRAWTLNETEGFLKIVIGEDNRILGANM
    IGENATEVINTITLAMELSLKIDDLYKVQFSHPTVSEIITEVVQRAIVGEIY

    >gi|15922019|ref|NP_377688.1| cation-transporter ATPase [Sulfolobus tokodaii str. 7]
    MSEVRNEKKDLRIKREEELKIVGMHCATCVSTVSKAISSVQGVKDVNVNLASGNARVVIENARLKDIVRAVRKAGYDVVT
    QKVTLKVSLSEEEAGKIVSVLDNIPGIIDVKINPSSGIVILEINPVTVTGDEIVEELKKRGYKAEITTESFKGKSDFHDL
    LIRLIIASVFSSLIFIFPAYQLFLSIPVQFYSGLRFHLGFLRALRNKTSNMDTLVSLSSNIAWFYSLYSYLIHSPNYFFE
    ASSLLITFILIGKTLEAYIKEKTSDDVIRLQTVKARLTDGTLVDSSKLRVGDVVIVKSGEIIPADGIVDEGEGYVNEAIY
    TGETIPVRKKKGDAVIGGSILTSGFLKVYVTRAGNRTYISQVIEAIREAETTRLPIQSLVDKVSSVFVPAVIGVSVLAFA
    LWYVVSHSLTFSILISVAVLASACPCPFGLATPMAVMVGIRKLVKKGIKVRNAESLERLREAKYIVFDKTGTITTGEFIV
    KPIGDENAIKLACAVEKLSSHPVGEAIASLYDVKDEVKDFNEFQGEGVYGKVNDHDVIVGKREFVLKNCEGDLDADVLVC
    VDSKVVAGFLLEDKIRDGVVELVNELKKYYEVIIATGDSSNFADKVGEVLGVKVYKGLSPDDKVELVRKLGKAIFVGDGV
    NDAQALKEALVGIAVSTGTDIAKYAGDIIVPSVLSIKYVIEQSKRTVRKIKENLAWAFTYNSVLIPISAGILYPFYLPPE
    YAALAMSMDSVLVSLWSFVQ

    >gi|15922096|ref|NP_377765.1| thiosulfate sulfurtransferase [Sulfolobus tokodaii str. 7]
    MLVSVKWLYENLNEVKILEIDFDPEINYYEGHIPSALLLPWKSLLHDKIRDFAPPEKFSKVLGNLGVKEDDLIVLYSDMG
    NRYAFYTYWLMKAYGHENVAILNGGIYKWLKEGYPVENEPTFPSKKSNYIVKRVDWSSRILLWELLSKLNSIELIDARNR
    EEYEGLTSAPPEHKCEQTQVSGHIPNAKNIPWTILFNEDGTLKGREELEKIFSSINKDKEIVVY
    CRTGARASAVWYVLKE
    VLSYKNVRLYDGSWVEYGNLVGVPIER

    >gi|15922097|ref|NP_377766.1| bacterioferritin comigratory protein [Sulfolobus tokodaii str. 7]
    MVEIGELAPDFELPDTELKKVKLSALKGKVVVLAFYPAAFTQVCTKEMCTFRDSMAKFNQVNAVVLGISVDPPFSNKAFK
    EHNKLNFTILSDYNREVVKKYNVAWEFPALPGYVLAKRAVFVIDKEGKVRYKWVSDDPTKEPPYDEIEKVVKSLS

    >gi|15922178|ref|NP_377847.1| lipoamide dehydrogenase [Sulfolobus tokodaii str. 7]
    MIVVIGSGPAGIYGAFTASALGEKVKLIEEKERLGGTCVLYGCIPSKAMLHPLYLKYSLERLGKKIDFSYEELIKLAQDA
    ISRISKGVEYMLESYGVEVIYGRGVLKSKEIEVSGQTLYPDKVLVATGTLKPEINGTIASDDLPYLNKEFNSVTVIGGGV
    GGIEYGWLLHKIGKEVHIVEKENLLLPKHDMDLRNYVTNHFKRIGVKLHLGVEAKIENNKVKLSNGEEIKSDIILMSFGR
    KPNLTGVESLPHDYWIKVNEYMETPIKDIYAAGDITGSFTAHEAIHKGYIAGLNMKGIKKPYDSSAVPKVIYTSPQIAYV
    GNTNSGRCMKMEFSGLARAIAEKETEGFLKICVENEKVIGGVAFSERAEEIISLLALGIKFKGSLDELLDFQYPHPSYLE
    MIWEILRKIKWG

    >gi|15922191|ref|NP_377860.1| hypothetical protein ST1877 [Sulfolobus tokodaii str. 7]
    MSEGEKKQKVLVVVTHGPEDLDRTYAPLFMASIAASMEYETSVFFMIKGPKLLDKKWQEEERRKGGNPFIHFFDMAKDNG
    VKMYV
    CVQSLKDMCHMNESDVVDGVEIVGGSTLIDLLFDADRALFF

    >gi|15922193|ref|NP_377862.1| dihydrolipoamide dehydrogenase [Sulfolobus tokodaii str. 7]
    MEYDVIIIGGGTAGYTAGVILGRRGKKIAVVEKEKFGGTCVNYGCVPSIFLSDISFLYSRLSEIGNYKGIEINLKLNNFF
    SKREEIIDYLSTAGKRLIENASGETIEGEGIIRDNHTVEVNGRLLTTKEIIIATGSKPKPPRIEGIENAISEDQVVRLNT
    IPSSMVIIGGGVAGTEIAQIFAKLGTKVTLLTRSKILKELHEETRKLMIDSLEFDGIDIIENSKIEKIYGEKVYTNKGVF
    DGEIVVYATGREPNYPKGFEKLNVEIGKEGIIVNERMQTNIKNIYAIGDIVNKEKKVAHVAYMEAIIASLNVLGTCEYMD
    YTGTPQVIYTDPQIGIAGEKDKAVKFLKFPYNADTRAIIKGLREGFALIGIDKNGTIVYSEIIGDNAEELINIMALAIRK
    RVTIRDLAFTIFIHPSLSEILVNAARGEFDLDVDLYK

    >gi|15922195|ref|NP_377864.1| hypothetical protein ST1881 [Sulfolobus tokodaii str. 7]
    MSYDYIVSQYLAYIKDITLEGCKAEEIFDYFKDKLNIVSKEGCDKPYIKVYKNNRLYFSYYGIPAINEFWPFLNALVRIS
    NNVIQLDEKEKELAANIRGNIKLFVTPD
    CTKCPIAAELLYQLPILNSNISLEIIDVTTYDDLGKKHRVLNVPKIVLNEKT
    EIPGSFPPTIILKMLAKGSEQH

    >gi|15922215|ref|NP_377884.1| hypothetical protein ST1899 [Sulfolobus tokodaii str. 7]
    MITFTVEGILEGDKVKVSVKDTEFTIGLLGSDYPTPEEVLLASALSCLMLTVYYVANEKGLRIEKMNGYIEGNLDPKGFQ
    GDPNIPPGFLDISYEIEVKADNKELLEKVLEESERRCPLKDTLTRSIKVNVKWKVI

    >gi|15922428|ref|NP_378097.1| thioredoxin peroxidase [Sulfolobus tokodaii str. 7]
    MPPNIGEQAPDFEAESTLGKIRLSDYKGKFVVLYFYPKSFTPGCTREIQRFSELYEEFKKLNAEVIGVSADSITTQKRFA
    EKYNAKFPVVADKEKKIIETYGVLNEKGTSAQRVTFIIDPEGKIIQILKNLKKAEEHADKALEIIKNKKS

    >gi|15922449|ref|NP_378118.1| thioredoxin [Sulfolobus tokodaii str. 7]
    MTSKDKISMTTEKDPELGKLLEKKAKELMSQKPKGEVIHLDSKNFDSFLASHKIAVVDFWAEWCAPCLILAPIIEELAED
    YPQVGFGKLNSDENPDIAARYGVMSLPTVIFFKDGEPVDEIIGAVPREEIEIRIKNLLGE

    >gi|15922579|ref|NP_378248.1| NADH oxidase [Sulfolobus tokodaii str. 7]
    METLVAVGGGAAGMSASSRARRLKPDMEIVVFESTKMVSHAPCGIPYFVEGLFNDENLFMTYTPQFFEEKRKIHVKTNTK
    VTEIDFDSRIVYGESREGKIKAEYDYLVISTGAIPRKIPVEDGNDRIFYAHHPANAVELRERLWSLNTIAIVGGGILGIE
    MAEALTHIGKKVILIHRSKYLLNKTIDTELGNIITQRVSKDAEVRLNESVETIKEGGRLIVTDKGKYQVDGTIIAIGVAP
    NVELVKDKIKLGETGAIKVDDHMRTNYREVYSAGDNTESVNIITKKPAWVPFAPVANKMGYVAGSNIGGHEMRFPGVVNT
    QITKYKEFYIGRVGLQEDEARLHGFKPISATISGKTRARYYPDAKDIHVKIIADENTKRILGAQIVGGEEVLGRIDMMAA
    AIMKGFTIEDTFFIEMGYLPAISRVWDPVIVAIRQLMKDE

    >gi|15922598|ref|NP_378267.1| hypothetical protein ST2267 [Sulfolobus tokodaii str. 7]
    MERYSRQLLVLGLELQQKLKELKVTVVGCGALGSTLVELLTRIGVGYIKVIDADIVEISNLHRTLLFTEKDVGKPKALVC
    KERAKEINNEVEIEAITDIIDETNVEELVKDSHYVFDALDNLYFRLLLNDACVKHSIPLIYGGVMGEYSSVKLVLPYKNA
    CLSCFLNYEGEEENV
    CETIGTLDTIVTTTASLQVQLMLNHLRGEEDNNLYYFDFRNMRFDKIKIERNEKCQACSLHEFRF
    LNSKEKKPACGIVKVEKEGPNNGFHIEKNKDGIIICYGDKCFKKVSR

    >gi|15922612|ref|NP_378281.1| hypothetical protein ST2281 [Sulfolobus tokodaii str. 7]
    MKVEIFTHKNCIECNFLIEFLEKKGLLSKVTIIDTELYPFLAFERGVISTPSIFVDGKLIFAGVVDYDELLKILSGEKVS
    VKINKEELIDKLMFGIINSFAATAWLYVNKDFDALMAQKDFVFAITGLALISESEAEEMYNYLRNVIVKEGDIYFEKWKD
    TMKRVISSNFIRELYWLYEKKLEKEYVMSKYPIEVFAHWLMVRGGAVGRVGLRIHSLSEKEIITRISEVYIYLFNNYDSL
    WDKVIKEQEEIRKSNKEQVRFLNF

    >gi|15922618|ref|NP_378287.1| hypothetical protein ST2286 [Sulfolobus tokodaii str. 7]
    MLMNRLKESKSAFLLQAVNSPIDWYPWGEEAFERAKKEDKPVLVDVGASWCHWCHVMDEETYNDPEVVKIINENFVAIKV
    DRDELPDLDRELQNLVSAITGESGWPLTVFMTPDKKVFFGGTYFPPEDRYGRIGFKRLLREILRVWKEDREKILEVTKAT
    SSLKLQFNTMTPEWEVIENSISSIVSVYDFENGGLQGEMKFPHPTVDELLLGYSFYTSSDTERKLSLFTLKKMFYGGIFD
    QVGGGFHRYTVDNEWYVPHFEKLLIDNAELLLDYLQAYQLTQDSDIYDCLRLMYNFLVRDMKIEGGFANSLDADSEGIEG
    YYYTWTEGEFSDALKGEDIDFWFKFFNLKLGKEVEGRKVLRRTIDSRDLAKYYSVEKLNEIRNKLLEYREKNRKKPFRDE
    NLYTYPNSRVAEALLYTYPILKAGLNDALEIVSKLSKNITRRLEGGKEGLLEDYASSTLALIAAYEVTGNDKYKDMALSL
    SQTLKDKEGYVLDSPNESPESLRLKALIKLSQITEEKIDVKIYESSPAFTSGVLFSVMSFLKGVAHIVIVDEKDGKAEGL
    HDTALTLYYPMKVVELIDDSKKDYLPSYMRSMINYNKGVSRAFVCIGNKCSMPIISGDKLKTYLGGVR

    >gi|15922774|ref|NP_378443.1| putative peroxiredoxin [Sulfolobus tokodaii str. 7]
    MSEEKIPLIGEKFPEMEVITTHGKIKLPDYYQGKWFVLFSHPGDFTPVCTTEFYSFAKKYEEFKKLNTELIGLSVDSNIS
    HIEWVMWIEKNLKVEIPFPIIADPMGNVAKRLGMIHAESSTSTVRAVFIVDDKGIVRLIMYYPMEIGRNIDEILRSIRAL
    QLVDKSGVVIPANWPNNELIGNKVINPPPRTVKDAKLRINQPFDWWFTYKEI

    >gi|15922897|ref|NP_378566.1| thiosulfate sulfurtransferase [Sulfolobus tokodaii str. 7]
    MSQTIQQQVVVDTKWLLEHLKDPNVRIVEVDYDPNTAYNVWHIQGAVLIRWREDLRHPVIRDFIEPSDFEKLMESKGISN
    NTTVVLYGDYNNWFAVYTFWLFKAYGHEDVRILNGGRTKWAKENLPTEQGPKEPQYPKGSYKVKKVDWGSHRAFFWEVLQ
    RVTKGEVGKTTILVDVRSPKEYTGEIRAPPEYADEQTQVGGHIPGAISFPWSQAVNPETGEFKPIEELRRLVESSGISQD
    KEIITY
    CRIGERAAHTWFVLKYLLGYPAVRVYDGSWAEWGNIVGAPVKKGNEP