Sulfolobus solfataricus P2 uid57721

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|15897143|ref|NP_341748.1| glutaredoxin-like protein [Sulfolobus solfataricus P2]
    MEQEYAELFSDEVKNALQDALKDMKNPVDVYVFVDNTDSNCQYCGVTTKFLEFMASAAPKDSNGSLLKVHIVDRANENSR
    KIFEEFNVERVPTVAFYNGYIRWTGAPLGEEIRALVETIVRLSQGESGLSQETVEAIKSKLNGKVKIETVVTPS
    CPYCPY
    AALMAHMVAFEACRAGKCNVISEVIEAYENQDIAEKYQVMSVPAIAINESIEFIGVPYEENFINAILEKQKIS

    >gi|15897242|ref|NP_341847.1| thiamine biosynthesis protein related protein (thiF) [Sulfolobus solfataricus P2]
    MSNSSIDIGVPSLPPPFSIGTISIPTFSRQHLFLKIILHYNLVERYSRQLIVLGLGIQQRLNELKILIAGCGALGTAVAE
    LLARLGVKELTIVDADVVDITNLHRVHLFDENDVGKPKAEVCAKKISLINSSIKINYIIDILDEENVERLISDKDYVFDA
    LDSLYYKLLLNDAIVKLGKILIYGGINGEYGSAKLIDPSQTSCLSCFIDYSDQDEIGNS
    CDVIGTTPLIVELTATLQVNL
    MLNHLRGNPDYSLFYIDSRELKIERINIEKNSQCKTCVLNEYPFLYQKISKPKCGIFRTNMKIPELDEPKVFKNLGNVTL
    CYPSIGCFEKRGR

    >gi|15897255|ref|NP_341860.1| hypothetical protein SSO0314 [Sulfolobus solfataricus P2]
    MQGKLNCEIEMEVQIFTHKNCVECNMLLEYLENKGLLGKVKIIDTELYPFLAFEKGVISTPSIFIDGKLVYAGIVDFEEF
    ERILSGQKVTKQIDKASLVEKLMLGIVDSFAATAWLYINRDFDSFLAQKDFVMAVTGLSLLDEREGDEYYNYLRNVMVKE
    GDRYLEEWKPRMLRNISSNFIREIFWLYERKISKETLTQKYPVEVFAHWLMIRSGAVGRVGLRIYPLSDSTVMKRVLEAY
    NFMLENYDEIFNKVQKEQMELKTKNKEQVRYLQL

    >gi|15897303|ref|NP_341908.1| thioredoxin (trxA-1) [Sulfolobus solfataricus P2]
    MSEIDSLIKEVAERLQKKAEEYGKKKEDVTLVLTEENFDEVIRNNKLVLVDCWAEWCAPCHLYEPIYKKVAEKYKGKAVF
    GRLNVDENQKIADKYSVLNIPTTLIFVNGQLVDSLVGAVDEDTLESTVNKYLK

    >gi|15897884|ref|NP_342489.1| NADH dehydrogenase [Sulfolobus solfataricus P2]
    MILILGGGFAGVSAYNQNKENSLVVDRKDYFLLTPWIIDFICGMKKLEDIIVKYKKVILGNVQKIDFKNKKVILDNSKEL
    TYDKLIVSLGHHQNLPRLKGAKEYAHKIETLEDAIELKRRLNEVKDITIIGGGATGVELAGNIKGKKITLVQRRNRLLPT
    MSTASSKKAEDLLRELGVNLMLGVEAIEIKKDSVVTSYGEIKTELTIFAGGLKGPQIVGNLHANKNHRLLVDKNLKSIEY
    NDVYGAGDCVTFEDKEIPMTADIAVAAGRVVMKNILGNEIEFKPKRLATTIRIRNEFFGDFGENYVEGKFAKILKDISYL
    ESLLLPRRLRE

    >gi|15897887|ref|NP_342492.1| thiosulfate sulfurtransferase [Sulfolobus solfataricus P2]
    MFFHIMLVSVEWLNNNLKDVKVVEIGYNPQINYYEGHIPGAVLINWRDFLDDNSRDFASPGKLSKVLGNAGINNDDLIVL
    YSEMNNRYAFYVYWILKAYGHSNLAILNGGIYKWLKEGYPIESDGIVVNKKSEYKARKPDWSSRILVWELLSKLKEFVLI
    DSRSKEEYDGLTTAPPEHKCEQTQMSGHIPGAKNIPWTILLNEDETMKSRDELERIFSWLSKEDKIVVY
    CRTGARASVAW
    YALKEVLGFKLVRLYDGSWVEYGNMVGVPVEKSVSDRF

    >gi|15897925|ref|NP_342530.1| hypothetical protein SSO1056 [Sulfolobus solfataricus P2]
    MTVITFTAEGRLDGDKVIVDLNGTEIKVGLLGSDNPTPEEFCLASAISCLILTVYYIAREKGVTINSIEGYIEGKMDTKG
    FQGVEEVPPGLLEVSYELIVYSKDSRISDILKEAEERCPMRDTLTRSVKVNINWKIKS

    >gi|15897941|ref|NP_342546.1| hypothetical protein SSO1074 [Sulfolobus solfataricus P2]
    MAIKIVFFHDVLCPFCFVTSRRLRKVVNKFKEEVVVKHKAFMIISSLEDLKAAAPTEEEAKEIFKQEFSIIKRYYPDYDP
    EKVIGKGKIIWVWSLPPLIACKAAEYQRGDNGYWDYFDKAQEKFFLEGENVNDDNILIQIAEELGLDVEKFKEDFKSKKA
    RMSVFEDEAEAHAMGIRGVPALLVNDYWLIRGVQEETYLESVIEDLLSNGGEPKKVKLKAYWEAT

    >gi|15897981|ref|NP_342586.1| glutaredoxin-like protein [Sulfolobus solfataricus P2]
    MSYDYVIKEYLNAIKKGDITIQQCNGDSLFHEFKNYVNVETLNNCKKPLVKVKRGDRVYYTYYGIPIANELWPFLNSLVR
    ISNNVVNLDEREVELAKQVRGSVKLFVTPD
    CTKCPITAEFLYQVSQINENVKLEIYDATEYEEERDKYRVLSVPKIIFND
    KVEIPGDSLQL

    >gi|15897983|ref|NP_342588.1| dihydrolipoamide dehydrogenase (pdhD-1) [Sulfolobus solfataricus P2]
    MKYDIVIIGGGTAGYVAGSILARKGKKVLVAEKEKFGGVCVNFGCVPSIFLFDATFLLNRFKEIVYYIGLDGEIEYKDLL
    FSKRNEIIDYLSNAGRKLIEDSGGETELGEVEIISPSTVKVNGRIVEFDNLIIATGSKPMVPSINGIENTLSEDDAVNLN
    SVPSSMVIIGGGYAGVEIAQMYSRLGSQVTLLSRSKILPTFPEDARSIIKDSLEFDGVNIEENIRIVKIHDGKVITEKGE
    VEGNVIVYATGRRPQLPKGIEILGLSINECGIVVDKYRRVKNNVYAIGDVIDKERKTAHSAILDAVIASLHILKDATFLP
    LIDNLKIPQVLYTDPQVGIVGNDKEAKEFSVFPFAATTRAIINGFKDGYVKLGINERNEIVFGEVIGDKAEELINILTLV
    VNNRIRIESLALMSFVHPSFSEAIVNAAKGFFDLDVDKYKSKDGKT

    >gi|15897984|ref|NP_342589.1| hypothetical protein SSO1125 [Sulfolobus solfataricus P2]
    MAQAQTQGQEEEQKKKILIVVTHGPEDLDRTYAPLFMASISASMEYETSVFFMIKGPKLLDKKWQEEERKKGGNPFIHFF
    DMAKENGVKMYV
    CVQSLKDMCHMKEDDVVEGIELVGGSTLIDLTLEADRTLFF

    >gi|15898295|ref|NP_342900.1| hypothetical protein SSO1462 [Sulfolobus solfataricus P2]
    MPKASLPYYSEVLIGVRKCMNVLVTKSLVEVRETEDYSLLFFLGAFFGAFLVLFEARIANCCTFGHILSGNLQMVISSFA
    FLIAVMLGVWITLSLVLRLRINSIGYR

    >gi|15898331|ref|NP_342936.1| methionine sulfoxide reductase A [Sulfolobus solfataricus P2]
    MEVATLGGGCFWCTEAVYKRVKGVISVKPGYSGGHVPNPTYEDVCTDTTGHAEVVQITFDSSIISYREILEIFFEIHDPT
    TLNRQGNDVGTQYRSIILYHNEEQRKIAEEMIREVEKRIGKKVVTELKPFEVFYEAEDYHHDFYDKHKYNPYCRLVISPK
    VKKFMKLFPDKVKIHEG

    >gi|15898352|ref|NP_342957.1| dihydrolipoamide dehydrogenase (pdhD-2) [Sulfolobus solfataricus P2]
    MKNNIMKVVIIGAGPAGVYSALTLSKHAKVTLIEREEKLGGTCVLYGCIPTKSILSQLIISRQASNMSLNTLREYALTSI
    NTISKSLEHLLNSHGIEVIHANGFLRSSMVHASNTSLAADKVLVSTGTRRERLGKVKFTEDLAYTNEDYNKVVIVGGDAG
    GIELGWMMKKLGKEVHLIDKNDLLLQNIDRTLSEIVTNFLSQIGIKLYLGKKVSKIDETSVTLEDNQKISGDAVFVTFGR
    KPNIEGFEEIPHEKYIYVDEYLRTQIPNIYAAGDIIGTFTAHEAIYAGIIAAKNMLGEKREFIVEGIPKVIYIYPQIAYV
    GTTNGNCVTFNTLNLTRTIVERESEGFLKICERDNRVIGAVAFMPYAEDVISLISVLIRYQISLKDTIDLVMPHPSYLEA
    ITEALNMLQSKG

    >gi|15898383|ref|NP_342988.1| dihydrolipoamide dehydrogenase [Sulfolobus solfataricus P2]
    MKYDVVVIGAGGAGYHGAFRLAKAKYNVLMADPKGELGGNCLYSGCVPSKTVREVIQTAWRLTNIANVKIPLDFSTVQDR
    KDYVQELRFKQHKRNMSQYETLTFYKGYVKIKDPTHVIVKTDEGKEIEAETRYMIIASGAETAKLRLPGVEY
    CLTSDDIF
    GYKTSFRKLPQDMVIIGAGYIGLEIASIFRLMGVQTHIIEMLDRALITLEDQDIVNTLLSILKLNIKFNSPVTEVKKIKD
    DEYEVIYSTKDGSKKSIFTNSVVLAAGRRPVIPEGAREIGLSISKTGIVVDETMKTNIPNVFATGDANGLAPYYHAAVRM
    SIAAANNIMANGMPVDYVDVKSIPVTIYTIPSLSYVGILPSKARKMGIEIVEAEYNMEEDVSAQIYGQKEGVLKLIFERG
    SMRLIGAWMIGVHSQYLINELGLAVAYGLNAKQLASFAEQHPSTNEIISYTARKVI

    >gi|15898450|ref|NP_343055.1| coenzyme PQQ synthesis protein E (pqqE-3) [Sulfolobus solfataricus P2]
    MIPISVLVTNAGTVSFHIKGEYNKDRPSKFSDVFRPVVTWNLTRKCNLKCLHCYINASPEGEDGSTTEEALRLIDEMAEM
    RIPLIIMSGGEPLMRRDFFELASYARIKGIKLALSTNGTLITESVAKKLKELDFSYVGISLDSYDPEFHDRFRGLNGAFN
    MTVKGIKNAINVGLNVGLRFTITARNIHQIDEYVKLALELGVKRITFYHLSASGRGKELREWMYTPEEYVGFINKMIDYA
    IKLSGKIEIETTLGQFDGVYIAKKLARDEEELEKYMKFVENSGGCGRKMISIYPNGDVYPCQFIDFYKLGNVREKPLKEI
    IKNIPDLFINTDKYLRGEYCDKCKYKSA
    CKGGDRARAYYWNGDVYGDDPLCPLKTLHI

    >gi|15898620|ref|NP_343225.1| thiosulfate sulfurtransferase [Sulfolobus solfataricus P2]
    MSQTLQQGVIVDNKWVLEHLKDPNVRIVEVDYDPNTAYNVWHIPGSVLIRWREDLRHPVLRDFIEPSQFEKLMESKGISN
    NTTIVLYGDYNNWFAVYAFWLFKAYGHEDVRILNGGRTKWAKENLPTEQGPKETQYPKGSYKVKKVDWGNHRAFFWEILQ
    KVTKGEIGKTTLLIDVRSPKEFTGEIRAPPEYADEQTQVGGHIPGAISFPWAQAVNPDTGEFKSVEELRRLVENVGITSD
    KEIITY
    CRIGERASHTWFVLKYLLGYPSVRVYDGSWAEWGNIVGAPVKKGAEP

    >gi|15898640|ref|NP_343245.1| coenzyme PQQ synthesis protein E (pqqE-4) [Sulfolobus solfataricus P2]
    MIPISVLVTNAGTVSFHIKGEYNRDRPSKFSDVFRPVVTWNLTRKCNLKCLHCYINASPEGEDGLTTEEALGLIDEMAEM
    KIPLIIMSGGEPLMRRDFFELASYARSKGIKLALSTNGTLISESVAKRLKELDFSYVGISLDSYDPEFHDKFRGLNGAFN
    MTVKGIGNAINVGLNVGLRFTITAKNIHQVDEYMKLALKLGVKRITFYHLSASGRGRELREWMYTLEEYVSFINKMIDYA
    IKLSGKIEIETTLGQFDGVYIAKKLARNEEELEKYLKFVENSGGCGRKMISIYPNGDVYPCQFIDFYKLGNVREKPLKEI
    IKNIPDLFINTDKYLKGRYCDKCEYKSA
    CKGGDRARAYYWNEDIYGDDPLCPLKTLHI

    >gi|15898858|ref|NP_343463.1| peroxiredoxin [Sulfolobus solfataricus P2]
    MVKVGDKAPLFEGIADNGEKISLSDYIGKHNIVLYFYPKDDTPGCTREACAFRDNWDLLKDYDVVVIGVSSDDINSHKRF
    KEKYKLPFILVSDPDKKIRELYGAKGFILPARITFVIDKKGIIRHIYNSQMNPANHVNEALKALKQIKEEEIS

    >gi|15898905|ref|NP_343510.1| putative peroxiredoxin [Sulfolobus solfataricus P2]
    MSEERIPLIGERFPEMEVITTQGRIKLPDDYKGRWFVLFSHPGDFTPVCTTEFYSFAKKYEEFKKLNTELIGLSVDSNIS
    HIEWIMWIEKNLKVEIPFPIIADPMGNVAKRLGMIHAQSSTATVRAVFVVDDKGVVRLILYYPMEIGRNIDEILRAIRAL
    QLVDKAGVVTPANWPNNELIGDKVINPAPRTIKDAKMRLGQPFDWWFTYKEVKTT

    >gi|15898932|ref|NP_343537.1| hypothetical protein SSO2151 [Sulfolobus solfataricus P2]
    MTQVIESYSSPFYKNIIDLPPSMVRKLWKSGKIMILDIRTPQEYEEHHIPGAILAPLDYLEHLTELFEDKEVAVVCEHGN
    RARYATYGMPHLYKKRAYYMIGGMALWMCLPVA

    >gi|15898979|ref|NP_343584.1| hypothetical protein SSO2204 [Sulfolobus solfataricus P2]
    MITTFKCVLVTKNIRMNERLMNSQSGYLRKAVNHPINWYTWSNDVFEIAKKENKPILIDVGAAWCHWCNVMDEDTYSNPE
    IAKIVNENFIPVKVDRDEMPDLDRLLQNAAMAITGESGWPLTIFMTPEGKVFFGGTYFPPEDRYGRIGFKRLLLEILRIW
    REDRNQILLSSIDPNMLIPKNTGGVLNSSVLDDAFSFITSYFDIEYGGLGFGAKFPHPFVDLLFLNYSATRGDDLGKKLG
    LFTLRKMYYGGIFDQVGGGFHRYTVDREWKLPHFEKLLIDNAELIYDYFTYYIATNDIEILDALRNSVDFVLRELYIDGK
    GFANSLDADSEGMEGKYYTWTEDELKDSLGNDYGIAIRVFDLKNTVEVEGRKVLLRTIELRELCKATGLQVNDMIKKISE
    IRTKLLAYRKQNRKMPYRDDNTYTYSNAKLAESMLYSSLILNKSIEEAKLVLSKLGKTVSRRLDGGKAGLPEDYAAALLA
    TISAYEVLGEERYYDLAIELGRNIGVIKPNNFTDMPNESANSMYIRALFKLSLLSDEFKVDEEKIKPLIPSLTAENSQFI
    AGIVNSISSYISGMAHVVVVDEKDGLAERLHKVALLTYYPFKLVEKVDDSRTDYVSSVIRAMIKYNVGRSRAYVCIGNTC
    SMPVSEEEKIKQLLKTKL

    >gi|15899007|ref|NP_343612.1| thioredoxin (trxA-2) [Sulfolobus solfataricus P2]
    MNDELNDPELQKILSKKTTQILNNLKEKVKEPVKHLNSKNFDEFITKNKIVVVDFWAEWCAPCLILAPVIEELANDYPQV
    AFGKLNTEESQDIAMRYGIMSLPTIMFFKNGELVDQILGAVPREEIEVRLKSLLE

    >gi|15899027|ref|NP_343632.1| peroxiredoxin [Sulfolobus solfataricus P2]
    MNVGEEAPDFEAESTLGKIKLSDFRGKKVILYFYPKSFTSGCTRELQRFTELYDEFKKLNAEVIGVSVDKIDTQKKFAEK
    YGAKFPIVADDQKTISKLYSVLNERGTSAQRVTFIIDENGKIVNILKNLKKAEEHADKSLEIIKRQNST

    >gi|15899050|ref|NP_343655.1| NADH oxidase [Sulfolobus solfataricus P2]
    MERLIIIGGGAAGMTAASWVRRLKPNMHVTVFESTKMVSHAPCGIPYFTEGLFDDENLFMTYTPEYFIEKRKINVKTNSK
    VEEVDLRSRIVVVRENQEKRKYEFDYLLFSTGARPKKINAEGDRIFYVHHPAEASYIRQKLWSFNRIAIIGGGILGIEMA
    EALRARGKKIVLIHRGRYLLNKMLDEDMGKIVTDKVESEIELKLNESLVSVIEEGRVVITDKGKYDVDATVVAIGVEPNI
    DLVKDQLKIGQTGAIWADNHMRTSVENVYAAGDSTESINIITKKPDWVPFAPVANKMGFVAGNNIGGKDVTFPGVVGTMI
    TKFEEFIIGKTGVTENEAKRYNIKTVSAIVHHKTRARYYPGSKDIIVKLIAEADTMRIIGAQIVGEEEVLGRLNMMAAVI
    QKGFTAEDLFFVETGYVPPVNRVWDVVTLAARKLFSGISGE

    >gi|15899168|ref|NP_343773.1| thioredoxin reductase (trxB-3) [Sulfolobus solfataricus P2]
    MSLLPRTTSVKPGEKFDVIIVGLGPAAYGAALYSARYMLKTLVIGETPGGQLTEAGIVDDYLGLIEIQASDMIKVFNKHI
    EKYEVPVLLDIVEKIENRGDEFVVKTKRKGEFKADSVILGIGVKRRKLGVPGEQEFAGRGISY
    CSVCDAPLFKNRVVAVI
    GGGDSALEGAEILSSYSTKVYLIHRRDTFKAQPIYVETVKKKPNVEFVLNSVVKEIKGDKVVKQVVVENLKTGEIKELNV
    NGVFIEIGFDPPTDFAKSNGIETDTNGYIKVDEWMRTSVPGVFAAGDCTSAWLGFRQVITAVAQGAVAATSAYRYVTEKK
    GKK

    >gi|15899228|ref|NP_343833.1| methylated DNA protein cysteine S-methyltransferase. (DNA 6 O methylguanine)(protein L cysteine S methyltransferase) (ogt) [Sulfolobus solfataricus P2]
    MLVYGLYKSPLGYITVAKDDKGFIMLDFCDCVEGNSRDDSSFTEFFHKLDLYFEGKPINLREPINLKTYPFRLSVFKEVM
    KIPWGKVMTYKQIADSLGTSPRAVGMALSKNPILLIIP
    CHRVIAENGIGGYSRGVKLKRALLELEGVKIPE

    >gi|15899293|ref|NP_343898.1| dihydrolipoamide dehydrogenase (pdhD-4) [Sulfolobus solfataricus P2]
    MKIAVIGSGPAGVSASLELAKNNKVVLVEKEERLGGTCVLYGCIPSKAMLHPIHLASELEKLGKNITFDLGELRKLGQDA
    SYRLSKGVEYMLEDNGVEVIHGIASLRSGQLIVNNETIQVDYVVLATGTYREVVKGIIYSEDLPYLNKDFKSVIIVGGDV
    GGVEFGWMLRKLGKEVVLVDKQSSLLPYLDKEVSNAITNYFSKIGVRLYLNRSVKEMKEKEVILENGEKLTADVVYMTFG
    RKPSIQGFEEINHNPFVIVDEYLRTSLSNVFAAGDIIGTHTAHEAMYAGKIAATNIMGGKKVFNKQGIPKVVYTHPTIAY
    VGSMEGKCVKINLVELGRAITEKEIDGFLKLCIKDDKIVGAQAFMKDAEEVISLISFLIRYNIKVNEIKDYVAPHPSYIE
    ALTELLNRL

    >gi|15899339|ref|NP_343944.1| peroxiredoxin [Sulfolobus solfataricus P2]
    MVEIGEKAPEIELVDTDLKKVKIPSDFKGKVVVLAFYPAAFTSVCTKEMCTFRDSMAKFNEVNAVVIGISVDPPFSNKAF
    KEQNKINFTIVSDFNREAVKAYGVAGELPILKGYVLAKRSVFVIDKNGIVRYKWVSEDPTKEPNYDEIKDVVTKLS

    >gi|15899360|ref|NP_343965.1| hypothetical protein SSO2634 [Sulfolobus solfataricus P2]
    MMLITERRSPFYPNIQNVPPSVIRKLVKNKAITLIDVRQPWEYEDHHIPGSILLPLDYFKELFPLVLSKNNLVKNGVAII
    CEHANRSTWLVYTEPSLFKEVKVYNMLGGIELWMIMGYEIEKGMDDNGTLWYKLLTKNLG

    >gi|15899375|ref|NP_343980.1| cation transporting ATPase (pacS) [Sulfolobus solfataricus P2]
    MDLRECHMATEKKEELRITDNEEQLRIVGMHCATCVTTVSKSLKSVSGVKDAEVNLATGSAKVILSGNVRLKELVKAVRK
    AGYDVATEKFTIKLNVNPEEMPKIERKFENVKGVVDVKSNPGLGIVSVEYNPETTTPEEILKEAGVKGEIVNEQRSEKSI
    LYKDFHDLLRRLAVGIIFTPLTYLLPFFFGILVSIAVQFYSGLRFHKGAYRALKNKTTNMDVLVSLASNILWLSSIFLHN
    TFYADASLLITFILVGKTLEAYIKAKMSAEIRIEPYKATLKDGRVVNSNELKVGDVVIVRAGERIPADGIIENGEGEVNE
    AILTGEQKPVLKKKGDNVLAGGILVNGYLEVYVTRNWDRSYIVQVTESVRGAYNTRVSIQNLVDKVSSIFVPIVISISAL
    TFLVWKFVLDYNLYSSLLFSVAVLAAACPCALGLASPMAMLVSVRRALKRGIIIRDGSIFEEMRNINVAILDKTGTVTEG
    EYVIVSKKEFIEGALNLAAIAESRSIHPIAKAFHKMNVRAGEIEQFEEFPGRGIYARVNGNDVIVGSKDFVRDNCNWNVE
    DEGDIFICINGNAGGIVNIRDKLRDDAKKVISYLKGRGIRIIIATGDSSNYADEIGKELGVEVRKELTPDDKAELVKELR
    ENGNKVMFIGDGINDSIAMREADIGIAISSGTDLAKSAGKVVVNSLDDIIGLFEQTELAVRKIKENLAWAFGYNTAIIPI
    AAGVFYPFITLPPEYAALAMGFSSVIVSLWSLVPI

    >gi|15899410|ref|NP_344015.1| mercuric reductase (Hg(II) reductase) (merA) [Sulfolobus solfataricus P2]
    MEDLVIIGYGAAGFAALIRANELGIKPVVVGYGEIGGTCVNVGCVPSKRMLRIGELYNYSSKVIGKKLFPEFFQAFQDKA
    EIVNSLRKEKYEDVINSYDIKLKIGKAYFTSPNAVKVNGEIIEAKKFIIATGSSPNIPNIKGLTEVGFWTNVEALSPDKT
    ISSLAIIGGRALALEFAQMYKRLGVDTTILQRSGRILPDWEPEISLSVKNYLEENDSIPIFTNVRVKEVRKGNGGKIIVT
    DKGEVEADEILLATGRKPNVDLNLDAAGIELNDKGGIKVNEELRTSNPNVFAAGDVIGGPMLEALAGRQGSIAAENAIMN
    VHRKIDMLSVPQVVFIEPNVAKVGLTALEAVKEGYDIDQRVVKMDNIAKARILRENYGLIKMVIDKKFRNILGVQMFGKY
    AAEVINEAALALRFRATIDDLIDTIHVFPTMGESLRIAALAFTGDVSKMSCCV

    >gi|15899481|ref|NP_344086.1| thioredoxin reductase (trxB-2) [Sulfolobus solfataricus P2]
    MPLKTYDTIIVGAGIAGLSAALYSSRQKLSTLVLSKDLGGQLTLTDLIENYPGIESTGGLTLAQKIEKQAKKFGAEFIYG
    EEVKEIAQESDLFIIKGIKGEYAGRALILAFGKTPREINVPGEQEFKGKGVSY
    CAICDAAFFKGKPAAVIGEGEPGIEAI
    ELLSNYANPAYYITSSSYLAGEEEIVKNVVNKPTVKILTSSRVLEIRGNSKVEELVIKRGDEILQLKVDGVIIEMGYTLK
    TEFLKGFVELNEKGEIIVDELGRTSREGVFAAGDVTQTPYKQAVVAAAEGVKAALSAYNYIRSKRGLPPVTVDWKAEKKK
    VSFRL

    >gi|15899608|ref|NP_344213.1| copper-transporting ATPase [Sulfolobus solfataricus P2]
    MMSQEQNNITKFYVGGMACAFCASTIEKGLKKIEGVNEVKVVLESSEVFVKYDNSLVSSEIIKKEIEKLGYYVSDRSLFS
    DELLKDSRRRSIISWSLTTLLGLLYFFEYYNIIFRVTIILLVTTNLFYIALPIYKGASHAIGKGILNEHVLYGVAGISSY
    ILGIVGFLEFNKNLFGFLFISSLLTSLHLSAGWMGAILNNKVEKALHKVIELRPPYAHLINGEDVPVTKLKKGDIVIVKP
    GEKIPLDGVVVDGESEVSEAIITGESEPVSKGKGDFVIGGSTNGSGYLKVKITEDYNNSYLSKIIGLVNYSKQKKSAILT
    FFDKVIDKIWVPLALAISIITVIAWGLYGILIGKDLWLYGIINGLLVSTIAYPCAIGFSSPSMALSLYEKMLHKGMIIKN
    SNVYEKIKEIDTIIFDKTGTLTYGTPIVTQFIGDSLSLAYAASVEALSSHPIAKAIVKYAKEQGVKILEVKDFKEISGIG
    VRGKISDKIIEVKKAENNNDIAVYINGEPIASFNISDVPRPNLKDYLEKLKNEGLKIIILSGDKEDKVKELSKELNIQEY
    YSNLSPEDKVRIIEKLKQNGNKVLMIGDGVNDAAALALADVSVAMGNGVDISKNVADIILVSNDIGTLLGLIKNRKRLSN
    AIPSNVILALTYNGIGIPLAIFGILTMKFAMIIMILSLFSIFINSRVFVNIIGFD

    >gi|15899795|ref|NP_344400.1| hypothetical protein SSO3085 [Sulfolobus solfataricus P2]
    MPSMVLQPVLQESWALIYGLFALSGFILGWAAQRGNYCFVNAMTSIFTAKSYERFGALLILFGLSALGSGLLVAFGVIPA
    FDQYYYNYFAGWYILVGSIIFGFGAALAGGCNLSMLYRAASGYVQNWIELFGMMIGTYVFAIGIWPFQLYTMANGILSTT
    NGGYVEYLPYIIFHSISNMSVYITTLVVSLPLIFIGIYLQQYTKRKWAISSSLRINLPAARAYYNQNISTSGEEKVSLTK
    EIKDLILLRKPYGTNLTTIILALDLLLVFIVGAGYTFNYLVITSSDGGRFFEYLLMLGNVKLFLNTPWFNDSLPIVDPST
    LMVIMLCIGAFSASYLSGDFKIRIPRNKSRLLIGFGGGMLVGIGVRMALG
    CNVGLMWTNFAQLGYDGIIFLFGMLLGVYL
    AIKVQERWL

    >gi|15899610|ref|NP_344215.1| copper binding protein [Sulfolobus solfataricus P2]
    MAKIRKLEVEVRNMCCGHCATNVSKSVKEISGVREVDVDLREGLAFISIDEKADMNRVINNIREKITDLGYMVGEIKIIG
    GV