Sulfolobus islandicus Y N 15 51 uid58825

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|229580743|ref|YP_002839142.1| protein of unknown function DUF255 [Sulfolobus islandicus Y.N.15.51]
    MNERLRNSQSGYLRKAVNHPINWYTWSNEIFEIAKREDKPILIDVGAAWCHWCNVMDEDTYSNPEIVKIVNENFIPVKVD
    RDEMPDLDRLLQNAAMAITGESGWPLTIFMTPEGKVFFGGTYFPPEDKYGRIGFKKLLLEILRIWREDRNQIFSSSIDPN
    MLIARNTGGVLSSSVLDDTFSYITSYFDIEYGGLGFGAKFPHPFVDLLFLNYSATRGDDLGKKLGLFTLRKMYYGGIFDQ
    VGGGFHRYTVDREWKLPHFEKLLIDNAELIYDYFTYYTATNDIEILDALRNSVDFVLRELYMDGKGFANSLDADSEGMEG
    KYYTWTEDELKGALGNDYGIAIRVFDLKNTVEVEGRKVLLRTTELRELSKVTGLQANEIIEKVSEIRAKLLTYREQNRKM
    PYRDDSTYTYPNAKLTESILFSSLILNKGIEEAKLVLSKLGKSVSRRLDGGKAGLPEDYAAALLASISAYEVLSEEKYYD
    LAIELGRNIGGIRPNNFTDMPNESANSMYIRALFKLSLLSDEFKVDEGKIKPLIPSLTAENSQFIAGIVNTISSYINGMA
    HIVVVDEKDGLAERLHRTALLTYYPFKLIERVDDSRTDYVSSVIRAMIKYNAGKSRAYVCIGNTCSMPVSEEEKIKQLLK
    TKL

    >gi|229580772|ref|YP_002839171.1| thioredoxin [Sulfolobus islandicus Y.N.15.51]
    MNDELNDPELQKILSKKANQILNSLKEKVEEPVKHLNSKNFEEFITKNKIVVVDFWAEWCAPCFILAPIIEELANDYPQV
    AFGKLNTEENQDIVMRYGIMSLPTVMFFKNGEPVDQILGAVPREEIEVRIKALLE

    >gi|229580789|ref|YP_002839188.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sulfolobus islandicus Y.N.15.51]
    MNVGEEAPDFEAESTLGKIKLSDFRGKKVILYFYPKSFTSGCTRELQRFTELYDEFKKLNAEVIGVSVDKIDTQKKFAEK
    YGAKFPIVADAQKTISKLYSVLNERGTSAQRVTFIIDENGKIVDILKNLKKAEEHADKSLEIIKEQNST

    >gi|229580815|ref|YP_002839214.1| CoA-disulfide reductase [Sulfolobus islandicus Y.N.15.51]
    MERLIIIGGGAAGMTASSWARRLKPNIDITVFESTKMVSHAPCGIPYFTEGLFDDENLFMTYTPEYFVEKRKINVKINSK
    VEEVDLRSRTITVRENQGNKKYEFDYLLLSTGAKPKKLNAEGDRIFYVHHPADASYIRQKLWSFDRIAIIGGGILGIEMA
    EALRARGKKLVLIHRGKYLLNKMLDEDMGKIITDKVGSEIELKLNESLISVTERGRLIVTDKGKYEVDATVVGIGVEPNV
    DLVKDQLKIGETGAIWADNHMRTSFENVYAAGDSTESINIITKKPDWVPFAPVANKMGFVAGNNIGGKDVTFPGVIGTMI
    TKFEEYVIAKTGITENEAKRHNIKTVSATVHHKTRARYYPGSKDIIVKLIAEANTMRIIGAQIIGEEEVLGRLNMMAAVI
    QKGFTAEELFFVETGYVPPVNRVWDAITLAARKLYTGISGE

    >gi|229580837|ref|YP_002839236.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Sulfolobus islandicus Y.N.15.51]
    MKKYDLLIIGCGASGFAAAIKASELTEGKIKIGMVCKGLLGGTCVNVGCVPSKYLIEITNKYYLSRKKFIGLELSAKINF
    TDIMGGLKKVVKELREEKYEKVLNYYSNVDLIKGDVTFIEPNKIRVNTEKGEQELSGSKIIIGVGSTCFASNMARRWLEE
    PKELLDWGQLEGLHHLLPYT

    >gi|229580885|ref|YP_002839284.1| FAD-dependent pyridine nucleotide-disulphideoxido reductase [Sulfolobus islandicus Y.N.15.51]
    MPLKTFDTIIVGAGIAGLSAALYSSRQKLSTLVLSKDLGGQLTLTDLIENYPGIESTGGLSLAQKIEKQAKKFGAEFIYG
    EEVKEIAQESDVFIIKGIKGEYAGRAIILAFGKTPREINVPGEQEFKGKGVSY
    CAICDAAFFKGKPAAVVGEGEPGIEAI
    ELLSNYANPAYYITSSSYLAGEEEIVKNVLNKPNVKIFTSSKVLEIRGNSKVEEIMIKKGDEIISLRVDGVIIEMGYVLK
    TEFLKGFVELNEKGEIVVDELGRTSREGVFAAGDVTQTPYKQAVVAAAEGVKAALSAYNYIRSKKGLPPVNVDWKAEKKK
    VSFRL

    >gi|229581035|ref|YP_002839434.1| Rhodanese domain protein [Sulfolobus islandicus Y.N.15.51]
    MSQVQEQQVIVDNKWVLDHLKDQKVRIVEVDYDPNTAYNVWHIPGAVLVRWREDLRHPVLRDFIEPSQFEKLMESKGISN
    NTTIVLYGDYNNWFAVYAFWLFKSYGHDDVRILNGGRTKWAKENLPTEQGAKEPQYPKGSYKVKKVDWGSHRAFFWEVLQ
    KITKGEVGRTTILVDVRSPKEYTGEIRAPPEYADEQTQVGGHIPGAVSFPWAQAVNPDTGEFKSIEELRRLVESAGITPE
    KEIITY
    CRIGERASHTWFVLKYLLGYPAVRVYDGSWAEWGNIVGAPVKKGTEP

    >gi|229581170|ref|YP_002839569.1| protein of unknown function DUF395 YeeE/YedE [Sulfolobus islandicus Y.N.15.51]
    MPSMVLQPVLQESWALIYGLFALSGFILGWAAQRGNYCFVNAMTSIFTAKSYERFGALLILFGLSALGSGLLVAFGVIPA
    FDQYYYNYFAGWYILVGSIIFGFGAALAGGCNLSMLYRAASGYVQNWIELFGMMIGTYVFAIGIWPFQLYTMANGILSTT
    NGGYVEYLPYIIFHSISNMSVYITTLVVSLPLIFIGIYLQQYTKRKWAISSSLRINLPAARAYYNQNISTSGEEKVSLTK
    EIKDLILLRKPYGTNLTTIILALDLLLVFIVGAGYTFNYLVITSSDGGRFFEYLLMLGNVKLFLNTPWFNDSLPIVDPST
    LMVIMLCIGAFSASYLSGDFKIRIPRNKSRLLIGFGGGMLVGIGVRMALG
    CNVGLMWTNFAQLGYDGIIFLFGMLLGVYL
    AIKVQERWL

    >gi|229581499|ref|YP_002839898.1| glutaredoxin-like domain protein [Sulfolobus islandicus Y.N.15.51]
    MEQEYAELFSDEVKNALQDALKDMRNPVDVYVFVDSEDSNCQYCSVTTKFLEFIASAAPKDGNGSLLKVHIVDRVNQNDR
    KIFEEFNVERVPTVAFYNGYIRWTGAPLGEEIRALVETIVRLSQGESGLSQETVEAIKSKLNGKVKIETVVTPS
    CPYCPY
    AALMAHMVAFEACRAGKCNVVSDVVEAYENQDIAEKYQVMSVPSIAINESVEFIGVPYEENFINAILEKQKIS

    >gi|229581636|ref|YP_002840035.1| UBA/THIF-type NAD/FAD binding protein [Sulfolobus islandicus Y.N.15.51]
    MITFLLAFSATCLNLSNSSIDIGVPSLPPPFSIGTISIPTFSRQHLFLKIILHYNLVERYSRQLLVLGLGVQQRLNELKI
    LIAGCGALGSAIAELLARLGVGEITVVDADVLDVTNLHRVHLFDENDVGKPKAEICAKKLSLINSSIKINYIIDILDEQN
    VEKLISDKDYVFDALDSLYYKLLLNDATVKLRKILIYGGINGEYGSVKLIDSNQTSCLSCFINYSDQDEIGNS
    CDVIGTT
    PLIVELTATLQVNLMLNHLRGNPDYSLFYIDSRELKIERINIEKNFQCKTCVLNEYPFLNQKITKPNCGIFRVNMKVTEL
    DKPKVFKNIGNAILCYPNIGCFEKRGR

    >gi|229581650|ref|YP_002840049.1| hypothetical protein YN1551_1020 [Sulfolobus islandicus Y.N.15.51]
    MEVQIFTHKNCVECNMLLEYLENKGLLGKVKIIDTELYPFLAFERGVISTPSIFIDGKLVYAGIVDFEEFERILSGEKVT
    RQIDKDKLVEKLMLGIVDSFAATAWLYINRDFDSFLAQKDFVMAVTGLSLLDEKEREEYYNYLRNIMIKEGEKYLEEWKP
    RMLRNISSNFIREIFWLYETKISKEVVMQKYSVEVFAHWLMVRGGAVGRVGLRIYPLSDSTLMRRVLEAYNFMLGNYDDI
    FNKVQKEQTELKAKNREQVRYLQI

    >gi|229581704|ref|YP_002840103.1| thioredoxin [Sulfolobus islandicus Y.N.15.51]
    MSEIDSLIREVAERLQKKAEEYGKKKEDATLVLTEENFDEVIRNNKLVLVDCWAEWCAPCHLYEPIYKKVAEKYKGKAVF
    GRLNVDENQKIADKYSVLNIPTTLIFVNGQLVDSLVGAVDEDTLESTINKYLE

    >gi|229582254|ref|YP_002840653.1| FAD-dependent pyridine nucleotide-disulphideoxido reductase [Sulfolobus islandicus Y.N.15.51]
    MILILGGGFAGVSAYNQNKENSLVVDRKDYFLLTPWIIDFICGMKKLEDIIVKYKKVILGNVQKIDFKNKKVILDNSKEL
    TYDKLIVSLGHHQNLPRLKGAKEYAHKIETLEDAIELKRRLNEVKDITIIGGGATGVELAGNIKGKKITLVQRRNRLLPT
    MSTASSKKAEDLLRELGVNLMLGVEAIEIKKDSVVTSYGEIKTELTIFAGGLKGPQIVGNLHANKNHRLLVDKNLKSIEY
    NDVYGAGDCVTFEDKEIPMTADIAVAAGRVVMKNILGNEIEFKPKRLATTIRIRNEFFGDFGENYVEGKFAKILKDISYL
    ESLLLPRRLRE

    >gi|229582257|ref|YP_002840656.1| Rhodanese domain protein [Sulfolobus islandicus Y.N.15.51]
    MLVSVEWLNNNLKDVKVVEIGYNPQINYYEGHIPGAVLINWRDFLDDNSRDFASPGKLSKVLGNAGINNDDLIVLYSEMN
    NRYAFYVYWILKAYGHSNLAILNGGIYKWLKEGYPIESDGIVVNKKSEYKARKPDWSSRILVWELLSKLKEFVLIDSRSK
    EEYDGLTTAPPEHKCEQTQMSGHIPGAKNIPWTILLNEDETMKSRDELERIFSWLSKEDKIVVY
    CRTGARASVAWYALKE
    VLGFKLVRLYDGSWVEYGNMVGVPVEKSVSDRF

    >gi|229582298|ref|YP_002840697.1| OsmC family protein [Sulfolobus islandicus Y.N.15.51]
    MTTITFTAEGKLERDKVIVDLNGTEIRVGLLGSDNPTPEEFCLASAISCLILTVYYIAREKGVAINSIEGYIEGKMDTKG
    FQGFKEVPPGLLEVNYELIVDSKDTRISEILKEAEERCPMRDTLTRSVKVNINWKIKS

    >gi|229582310|ref|YP_002840709.1| DSBA oxidoreductase [Sulfolobus islandicus Y.N.15.51]
    MVVKITFFHDVLCPFCFVTSRRLRSVARKFNDEIVVKHKAFMIISSLDDLKAAAPTEEEARELFKQEFSIIKRYFPDYDP
    EKVIGKGKITWVWSLPPLMACKAAEYQRGDNGYWDYFDKAQERFFLEGENVNDDNVLIQIAEELGLDIEKFKEDFKSKKA
    RMSVYEDEAEAHAMGIRGVPALLVNDYWLIRGVQDETYLESVIEDLLSNGGEPKKVKLKAYWEAT

    >gi|229582352|ref|YP_002840751.1| glutaredoxin related protein [Sulfolobus islandicus Y.N.15.51]
    MSYDYVIKEYLNAIKKGDITIQHCNGDDLFHEFKNYVKVETLDNCKKPLVKVKKGDRVYYTYNGIPIANELWPFLNSLVR
    ISNNIVNLDEKEMELARQVRGNVKLFVTPD
    CTKCPITAEFLYQVSQINENVKLEIYDTTEYEEERDKYRILSVPKIIFNE
    KVEIPGGFPSTMILKMMLKALQSELR

    >gi|229582354|ref|YP_002840753.1| FAD-dependent pyridine nucleotide-disulphideoxido reductase [Sulfolobus islandicus Y.N.15.51]
    MKYDIVVIGGGTAGYVAGSILARKGKKVIVIEKEKFGGVCVNFGCVPSIFLFDVTFLLNRFKEIVYYLGLDGEIEYKDLL
    FSKRNEIVNYLSNAGRRLIEDSGGETELGEAEIISPSEVKVNGRIVEFDKLIIATGSKPMIPNIDGIDDAISEDDAVNLN
    SIPSSMVVIGGGYAGVEIAQIYSRLGSQVTLLSRSEILPTFPEDVRSVVKDSLEFDGVNVVENTRIVKLRDGKVITEKGE
    IEGNVVVYATGRRPQLPKGIEKLGLEIDECGINVDKYKQIKNNAYAIGDVINKERKTAHSAMFDALVASLHILKETAFIP
    PDNFKIPVVLYTDPQVGVIGDHKEAKKFSVFPFAAITRAIINGIKDGYVKIGINERNEIVFGEVIGDKAEELINILTLVV
    NNRMRIESLALMPFVHPSLSEAIVNAAKGFFDLDVDRYKSKDGKT

    >gi|229582355|ref|YP_002840754.1| DsrE family protein [Sulfolobus islandicus Y.N.15.51]
    MAQAQTQGQEEEQKKKILIVVTHGPEDLDRTYAPLFMASIAASMEYETSVFFMIKGPKLLDKKWQEEERKKGGNPFIHFF
    DMAKDNGVKMYV
    CVQSLKDMCHMKEDDVVEGIELVGGSTLIDLTMEADRTLFF

    >gi|229582435|ref|YP_002840834.1| Radical SAM domain protein [Sulfolobus islandicus Y.N.15.51]
    MIPISVLVTNAGTVSFHIKGEYNKDRPSKFSDVFRPVVTWNLTRKCNLKCLHCYINASPEGEDGSTTEEALRLIDEMAEM
    RIPLIIMSGGEPLMRRDFFELASYARIKGIKLALSTNGTLITESVAKKLKELDFSYVGISLDSYDPEFHDKFRGLNGAFN
    MTVKGIKNAINVGLNVGLRFTITARNIHQIDEYVKLALELGVKRITFYHLSASGRGKELREWMYTPEEYVGFINKMIDYA
    IKLSGKIEIETTLGQFDGVYIAKKLARDEEELEKYMKFVENSGGCGRKMISIYPNGDVYPCQFIDFYKLGNVREKPLKEI
    IKNIPDLFINTDKYLRGEYCDKCKYKSA
    CKGGDRARAYYWNGDVYGDDPLCPLKTLHI

    >gi|229582520|ref|YP_002840919.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sulfolobus islandicus Y.N.15.51]
    MNNKNKRNEGLKRSRIAIYSVIFIIILIIGLYFILSKSNNVGVAVGDIAPNATFTLINGTKINLYNFHGKYVLLYFIVTW
    CETCAEGLHILSQIIPTLASKNITVIVVESYNDLGYQGIPLNEFIKSYANSNITFYYGYATLAMTKEYNPNGYLDIYYLL
    SPSGKIIYIAVVLL

    >gi|229582606|ref|YP_002841005.1| FAD-dependent pyridine nucleotide-disulphideoxido reductase [Sulfolobus islandicus Y.N.15.51]
    MKVVIIGAGPAGVYSALTLSKNAKVTLIEKEEKLGGTCVLYGCIPTKSILSQLIISRQASNMSLNTFREYALGSINTISK
    SLEQLLNSHGIEVIHANGFLRSSMVHASNTSLTADKVLVSTGTRRERLGKVKFTEDLAYTNEDYNKVVIVGGDAGGIELA
    WMMKKLDKEVHLIDKNDLLLQNIDNTLSEVVTNFLSRIGIKLYLGKKVSKIDETSVTLEDNQTISGDAVFVTFGRKPNIE
    GFEEIPHEKYIYVDEYLRTQIPNIYAAGDIIGTFTAHEAIYGGIIAAKNMLGEKREFLVEGIPKVIYIYPQIAYVGTTIG
    NCVTFNTLNLTRTVVEREGEGFLKICERDNRVIGGVAFMPYAEDVISLISVLIRYQINLKDTIDLVMPHPSYLEAITEAL
    NMLQSKE

    >gi|229582862|ref|YP_002841261.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sulfolobus islandicus Y.N.15.51]
    MVKVGDKAPLFEGIADNGERISLSHFIGKHNIVLYFYPKDDTPGCTREACAFRDNWDLLKDYDVVVIGVSSDDINSHKKF
    KEKYKLPFILVSDPDKKIRELYGAKGFILPARITFVIDKKGIIRHIYNSQTNPANHVNEALKTLKQIKAEEIS

    >gi|229583135|ref|YP_002841534.1| putative peroxiredoxin [Sulfolobus islandicus Y.N.15.51]
    MSEGRIPLIGEKFPEMEVITTHGKIKLPDDYKGRWFVLFSHPGDFTPVCTTEFYSFSKKYEEFKKLNTELIGLSVDSNIS
    HIEWVMWIEKNLKVEVPFPIIADPMGNVAKRLGMIHAESSTATVRAVFIIDDKGTVRLILYYPMEIGRNIDEILRAIRAL
    QLVDKAGVVTPANWPNNELIGDKVINPAPRTIKDAKMRLGQPFDWWFTYKEVKTT

    >gi|229583152|ref|YP_002841551.1| FAD-dependent pyridine nucleotide-disulphideoxido reductase [Sulfolobus islandicus Y.N.15.51]
    MREKSCDYLIIGSGIAGYNALKELLELKPNSKIIMVSSDKYYPYDRPPLSKDYLRGEMAREKLFFESEDFYKRGNLDVVL
    NRSVERIDTDSKEAVLNDGSVISFDRALIASGGRPRRLSVPGGENALYLRTLDD
    CDGIREVASRSRNALIIGAGFIGVEV
    ASSLTTLGVRTTVVEVMPYIWNTFVDEKVSMVIRQYLEGKGISFILNESVREIQGKAAITSGGKRLEADMFLIAVGIVPN
    VEVAQKSGIQVDNGIIVNEYLETSAKDIYAAGDIANIFDPREGRRKRIEHWNNAEYTGKLAARNMAGNGEAYNFISSIWS
    DIFDIHIESAGETRNYDEYVIRGRFNSDNPNFNVIYLKGGIVKGYVAINRDYGELEVLNKLIKEGKDVSNKKNSLADEGF
    DLKELLK

    >gi|229583153|ref|YP_002841552.1| conserved hypothetical selenoprotein [Sulfolobus islandicus Y.N.15.51]
    MQDPVCKMEVENTTPYRINYRGITYYFCSKGCLDEFKKNLTKYVSPADLNKKIDVKIVYCRPCKYMDRALNLAKDILSYF
    EEVNVELVQGDRGILDIYVNDELVFSRYIEKRFPESEEILKSIGQKLQLARQS

    >gi|229583242|ref|YP_002841641.1| thioredoxin reductase [Sulfolobus islandicus Y.N.15.51]
    MSLLPRTASVKPGERFDVIIVGLGPAAYGAALYTARYMLKTLVIGETPGGQLTEASIVDDYLGLIEIQASDMIKVFNKHI
    EKYEVPVLLDIVEKIENSGDGFVVKTKRKGEFKADSVILGIGVKRRKLGVLGEQEFVGKGISY
    CSVCDAPLFKNRVVAVV
    GGGDSALEGAEILSSYSTKVYLIHRRDSFKAQPIYVETVKKKPNVEFVLNSVVKEIKGDKVVRQLVVENLKTGEIKELNV
    NGVFVEIGFDPPTDFAKSNGIETDTNGYIKVDEWMRTSVPGIFAAGDCTSMWLGFRQVITSVAQGAVAATSAYRYVTEKK
    GKK

    >gi|229583312|ref|YP_002841711.1| methylated-DNA/protein-cysteinemethyl transferase [Sulfolobus islandicus Y.N.15.51]
    MLVYGLYKSPLGYITVAKDDKGFIMLDFCDCVEGNSRDDSSFTEFFHKLDLYFEGKPINLREPINLKTYPFRLSVFKEVM
    KIPWGKVMPYKQIADSLGTSPRAVGMALSKNPILLIIP
    CHRVIAENGIGGYSRGVKLKRALLELEGVKIPE

    >gi|229583364|ref|YP_002841763.1| heavy metal translocating P-type ATPase [Sulfolobus islandicus Y.N.15.51]
    MLSSFIRLYHITNYKLYSLYIFVTILTHMTTQNKELRIERFYVGGMACSFCASTIEKGLSKVNGVESARVFLESGEVIIK
    YDKSLVSLELLKKEIERLGYYVFDKTLDSSAVLKDSKRRALISWLLTIISFLLTLPMMINVYTLPYYIFYVNILIVTFSL
    FYIALPIHEGALNALKKGILNEHVLYGVAGISAYILGLIGILNPNLRTFLFISALLTSLHLTSGWMGAILRYKAEKALSK
    IVELRPPIAHLIDGRDVPITQLKKGDVVIVKPGEKIPLDGVVIDGESEVSEAIITGESEPVIKKVGDTVIGGSTNDNGYL
    TIRITNDYSTSYLTRILGLVNEAKQGKSRMMTFFDKVVDRIWVPFVLTISFLTFLGWLIVGHWVYGIINALLVMVIGYPC
    AIGFSYPSVDLSLYEKYINLGILIKNINILEKFSNIKAIILDKTGTLTYGLPIVKEFYGDIKALTYAASIERFSSHPIAK
    AIIQYSEKKGIRFLEVKNFREIIGKGVMGEIEGNKVFIGRREAANCDVNNEDINIVICVNGRLVGGFIIKDVLRSDAEEF
    VKEIRKLGINPIMLSGDKENIVKIIAESIGIKEFYGNLSPEDKVKIVKAIREKLNGNIMMIGDGINDGGALAFSDISVAM
    GNAVDISKNVADIILVGNNFSSLLLMLKKRNRLAKAPALNVIIALSYNAIGIPLAILGILSGPLAMLIMILSLISVFANA
    RLSMIYA

    >gi|229583396|ref|YP_002841795.1| mercuric reductase [Sulfolobus islandicus Y.N.15.51]
    MEDLVIIGYGAAGFAALIRANQLGIKPVVVGYGEIGGTCVNVGCVPSKRMLRIGELYNNSSKIVGKKLFPEFFQAFQDKA
    EIVNSLRKEKYEDVINSYDVKLIIGKAHFISPNAIKVNGETIEAKKFIIATGSSPNVPNIKGLTEVGFWTNVEALSPDKT
    ISSLAIIGGRALALEFAQMYKRLGVDTIILQRSERILPDWEPEISLSVKNYLEKNDNIPIFTNVRVKEVRKGNGGKIVVT
    DKGEVEADEILLATGRKPNVEMNLDAAGIELNDKGGIKVNEELRTSNPNVYAAGDVIGGPMLEALAGRQGSIAAENAIMN
    VKRKIDMSSVPQVVFIEPNVAKVGLTALEAMKEGYDIDHRVVKMNNIAKARILREDYGLIKMVIDKKFRNILGVQMFGKY
    AAEVINEAALAVKFRATIDDLIDTIHVFPTMAESLRIVALAFTSDVSKMSC
    CV

    >gi|229583435|ref|YP_002841834.1| heavy metal translocating P-type ATPase [Sulfolobus islandicus Y.N.15.51]
    MVTEKKEELRITDKEEQLKIIGMHCATCVMSVSKSLKSVSGVKDAEVNLATGSAKVILSGNVRLKELVKAVRKAGYDVAT
    EKFTIKLNVNPEEMPKIKRKFENVKGVVDVKSNLGLGIVSVEYNPESTTPGEILKEAGVKWEIINEQRSERSILYKDFYD
    LLKRLVIGITFTPLTYLFPFFLGILLSIPIQFYSGLRFHKGAYRALKNRTTNMDVLVSLASNILWFSGIFLHSTFYADAS
    LLITFILVGKTLEAYIKAKMSSEIRIEPYKATLKDGRVVNSNELKVGDIVIVRTGERIPADGIIESGKGEVNEAIITGEQ
    KPVLKRKGDNVLAGGILVNGYLEIYVTRNWDRSYIIQVIESVRGAYNARVSIQNLVDKVSSVFVPIVITLSALTFLVWKF
    VLGYNLYSSLFFSVAVLAAACPCALGLASPMAMLVSVRRALKRGIIIRDGSILEEIRNVNVAVLDKTGTVTEGEYVIVSK
    KEFINGALDLAAIAESRSIHPIAKAFHKMNMKDGKVEQFEEFPGRGIYARINGNDVIVGSKDFVKSNCDWNVEDEGDILV
    CINGRAGGIVNIRDKLRDDAKRVINYMKERGIMVIIATGDSSNYADEIGKELGIEVRKGLTPDNKAELVKELRENGNKVI
    FIGDGINDAIAMREADVGIAISSGTDLAKSAGKVVINSLGDVIGLFEQAKLGVRKIKENLAWAFGYNTVIIPIAAGLFYP
    TIYLPPEYAALAMGFSSVIVSLWSLVPI

    >gi|229583450|ref|YP_002841849.1| Rhodanese domain protein [Sulfolobus islandicus Y.N.15.51]
    MMLITERRSPFYPNIQNVPPSVIRKLVKNKEIQLIDIRQPWEYEDHHIPGSILLPLDYFEDLFQLMLNKSNIGIICEHAN
    RSTWLVYTKPSLFKEVKVYNMLGGIELWMMMGYEVEKGMDDNGTLWYKLLTKNLR

    >gi|229583472|ref|YP_002841871.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sulfolobus islandicus Y.N.15.51]
    MVEIGQKAPELELVDTDLKKVKIPSDFKGKVVVLAFYPAAFTSVCTKEMCTFRDSMAKFNEVNAVVIGVSVDPPFSNKAF
    KEQNKLNFTIVSDFNREAVKAYGVAGELPILKGYVLAKRSVFVIDKNGIIRYKWVSEDPTKEPNYDEIKDVISKLS

    >gi|229583518|ref|YP_002841917.1| FAD-dependent pyridine nucleotide-disulphideoxido reductase [Sulfolobus islandicus Y.N.15.51]
    MKVAVIGSGPAGIDASLELAKNNKVILVEKEERLGGTCVLYGCIPSKAMLHPIHLASELEKLGKSIVFDLGELRKLGQEA
    SFRLSKGVEYMLEDNGVEVIYGVASLRSGQLNVNNETLQTDYIVLATGTYREVVKGIIYSEDLPYLDKDFQSVVIVGGDV
    GGVEFGWMLRKLGKEVVIIDKQSSLLPYLDKEVSNAITNYFSKIGMKLYLNRSVKEMKEREVVLENGERLTADVVYMTFG
    RKPSIQGFEEVNHNPFVTVDEYLRTSISNVFAAGDIIGTHTAHEAMYAGKVAAINVMGGKKVFNKQGIPKVVYTHPTIAY
    VGNMEGKCAKINLAEIGRAITEKETDGFLKICVKDDKIVGAQAFMKDAEEVISLISFLIRYNIKVSEIKDYVAPHPSYIE
    AITELLSRL

    >gi|229583540|ref|YP_002841939.1| Rhodanese domain protein [Sulfolobus islandicus Y.N.15.51]
    MTQVIESYSSPFYKNIIDLPPSMVRKLWKSGKIIILDIRTPQEYEDHHIPGAILAPLDYLEHLTELFEDREVAVVCEHGN
    RASYATYGMPHLYKKKAYYMIGGMALWMAMGYEVESGMDENGVLWQKILEMKFNY