Candidatus Korarchaeum cryptofilum OPF8 uid58601

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|170289799|ref|YP_001736615.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Candidatus Korarchaeum cryptofilum OPF8]
    MLKYAALIPILLVAVALPIILQPLMLSATDFEADIYGGGTFRLSDFKGKVVVIVVAQTSCPHCKEFLPALSKAWKSDSEL
    MSGKYVVAVVMLDPAHPLSATGVSEDKKAFDSFSPPSGWILLPEAWHSIEVFGIKYTASVVIVDKQGNVVEKVEPQDHPK
    IDEMVSYTIMKVKESGAEAKVLRFSFSAPRLAFIGDTVTLQGEVQPPSVGVNVTIIRPDGEEINVRPRVIGNGQFSVDFT
    PDMEGTWVARASSLSETREVRITVLPNKPRGIESYDVVYGTHDERAGKIINQNAKSSKSLPNDNVVLLGGPKANPFVPEF
    NSIAGVSMILKGKSAKLFIGSKEYDLSVTFGKEDYAVVYWLRWEGRFVVVGEGFTRFGTLAASLFMKNTKLEKQLYLIHW
    KDLNGDGDVSYDEIEVLMTLEKI

    >gi|170290171|ref|YP_001736987.1| OsmC family protein [Candidatus Korarchaeum cryptofilum OPF8]
    MVVSTEYKDIEIRASGRRVSPTMSEVRCGNFELSIDKLGGEAPSPLDLMLASLIGCLNITATLVANDMGIKIEDATFEAI
    GIFNPSVFYGKEGQRAGYKEIKLLFRVKSDADDEKLKEFIRRVEERCPVSDNIANITPLTVKVERI

    >gi|170290262|ref|YP_001737078.1| Thiol-disulfide isomerase or thioredoxin [Candidatus Korarchaeum cryptofilum OPF8]
    MRYNLLLPLMMLSILLLSATPNNTLELSSGKVAVMFWSELCFNCERILPVWRSIERDPPAGIKVIDIKLIPGKNENIFVE
    FGIKETPTIILFENGREVKRISGLSDASESYLRDWIEGKSGLQLISFAFPVLGGLLALSPCSLPIMMSLTPLGRFSRRRD
    YATCFISSALGVISLGMAFLLISSLLKLVVRWIIYALALFSVTLGIFMILSPEKSCRMTGKVKSSFTCFSLGFLAMQCNL
    PLVIGSFMLLSASDFAQGIVNLISLSLGMSLTFLIVVRTSKGISARLSPSRSFNVSRLGGALLTLIGLYLIISNI

    >gi|170290353|ref|YP_001737169.1| UBA/THIF-type NAD/FAD binding protein [Candidatus Korarchaeum cryptofilum OPF8]
    MGEILLTEDEIDRYARQLVLRDIGLRGQERLKSSRVAILGMGGLGTPAALLLTRMGIGFIRIVDRDIVSGTDLHRQVLFN
    LDDVGLPKVEAAKTSLNKMNPDVEIDAIAIPILNENIDKLIEDVDLIIDGLDNIRTRYIINRAALRMGKPYIFSAAVEMF
    GIVSTIIPGETPCLECFYSGLQDEFLPR
    CAVVGVHPSITFITSAIAVSEATKLIVSGEPGLKGKLLFIDLRSMDFNLLEL
    KRDENCGVCGRGVAPEIEQPLVELGCARDGKSVYFINKFIDGFNMDEAVTNILKIGSITRMGDQFIKFKIDESLQGTLFK
    SGSMIIEVSGMATLNEREIIGIYESISNVKIYR

    >gi|170290379|ref|YP_001737195.1| heterodisulfide reductase, subunit A [Candidatus Korarchaeum cryptofilum OPF8]
    MPKVGVYVCHCGKNIAGKVDVQRVAAEMKKHPQVTVSRHYFFMCSSFGQELIKRDIKAGKVDRVVVAACSPKLHEPLFRG
    VVEEAGLNFGYYEQANIRELVSWSTEDPEEATRKAIAYTWAAVERVLEAEPVESEEFRVNREALIIGGGVAGIAAALDLA
    EKGIRVHIIERSPTIGGKMALLDRVFPTGDCSL
    CILTPMMAEAEHNPNITIHTMCEVTEVSGSVGDFRVRVKKRARYVDQ
    DKCVACGICAESCPVEVLNEWYARLGKRKAAYIPFPQSVPRAYVIDRENCLFFRDGSCRKCEEVCPAKAIDLSESDGEFE
    LRVGAIIVATGADEYDASNLKNYGYGKIADVITHFGFESLINVNGPTGGHLRRPSDGKVPESILFVQCAGSRDVNNNPYC
    SNVCCMITLKHAEIIRMEYPETKVYVAYIDMRTPKKGFEEMYARVREEGVVFIRGKPGEIRREGDKLVTEIYDEVLGEKL
    RLEVDMVVLAAGLSPSEGTLSISRTLNIPRDLYGFLQELHPKLKPVQTSRPGIFICGTAQGPKDIPDSVTQAKAAASEAA
    RLLMIGKVLVTGEKAKVNSELCTGCGACVEECPFSAIVLEEGKAKVLPLACMGCGICQGACPTGAIERRLYDHGQILNQI
    DGLLEVVT

    >gi|170290575|ref|YP_001737391.1| redoxin domain-containing protein [Candidatus Korarchaeum cryptofilum OPF8]
    MRYAALLIIMLLIPSIAASALPKEGSKAPVMRAVTYDGKAVSTTSLQGKIVVLMFVAEWCPHCREELPALSKAWKEYGLE
    SGDIVGIVMMVSSSESMAIEFFKSVNPPSNWKLVLEGEDTAESFGVSGVPTTVVIDRNWTVAGVFVGVLPPDEVLEPAIK
    LVGAGSQGNYTPVTSPATPSTTPKAEGGVQTILIVIIALALAIVIYLGYRMRGKRKK

    >gi|170290645|ref|YP_001737461.1| peroxiredoxin [Candidatus Korarchaeum cryptofilum OPF8]
    MEEGRIPLLGEKFPEIEVKTTHGVFKLPDHYKGKWFILFSHPADFTPVCTTEFVAFQKRYDEFRKLNAELIGLSIDQVFS
    HIKWIEWIEEKLGVKIEFPVIADDLGRVAGKLGLIHPNKGTNTVRAVFIVDPHGFIRLILYYPQEIGRNIDEILRALKAL
    QTSDKYEVATPANWPNNELIGDKVIVRPASDVETAKQRLELAKAKEIECYDWWFCYKKV

    >gi|170290667|ref|YP_001737483.1| thioredoxin reductase [Candidatus Korarchaeum cryptofilum OPF8]
    MFFMPQARVERDNDVIIVGGGPGGLTAAIYLARYGLKVLVIEKSVPGGKININPVIENYPGFESISGEELGRRMHEHALK
    SGARILSPEEVVKLELTGELKRVYTSSGKEFQARALIIATGAEERKLGIPGEGEFFGKGVSY
    CAVCDGPLFKGKRVIVVG
    GGNTAAISSIYLSKIAKEVILVHRRSSMRAEKALVDNLMSRENVKFLFNSVLTAIVGEGRVEGARVRDLESGEESFIEAD
    GVFILIGVEPNSKIAREAGVETDERGFIKVDCWQRTNIPGVYAVGDVTGEPLQIAKAVGDGVRAAVDIYDRIFGGSYARA
    SSQGPSRTS

    >gi|170290728|ref|YP_001737544.1| heterodisulfide reductase, subunit A [Candidatus Korarchaeum cryptofilum OPF8]
    MKPVAVIGGGIAGIQAALDLANQGIKVYLIERTPSIGGRMAQLDKTFPTLDCSMCILTPRMVEVARNKNIELLTYCDLID
    LKGSVGNFKLKVRKKPRYVDVDKCTGCMVCSKYCPSKVPDEYNEGMSERKAIYIPFPQSVPLKATIDAEHCLWFQKGICR
    NCEKFCPAKAINYDQKPEDIELDVAAVIFATGYELIMDAEFLREQYGYSRYANVYTNLEYERIVSATGPTGGEILRRSDK
    AHPKRIAFIQCVCSRDARINPNCSSICCMASVKEAILTKEHMHDVDVTVFYMDVRAFGKGYQEFYDRAKQEFGIRFVRSK
    PAKIVEDPSTKNLIVYYEDTQSSKFVKEEFDMVVLAVGVRPVKPDSFIPMSEDSFAQLKDPIMEPVSSPIPGIFVVGMLS
    GPKDIPDSVVQASAAAMKASLIAVSH

    >gi|170290833|ref|YP_001737649.1| NADH oxidase [Candidatus Korarchaeum cryptofilum OPF8]
    MKNNIGTSMDYVVIGHGTAGQTVAAVLKKVDPESNVTVIEKGIHVAIHPCSLPMVLSGKLSPQDIEERVPRGKVNVLLRS
    EAKKIDRERKILYFIRDGTQESIQYDKLILATGLSPIIPKIEGMDLEGVGTVWNLETVSELLKYLGNRVVVVGGSATGIE
    VASELASTGRDVTLIEAMEQLMPGKVDPPISSMVMNALNDLGVKVMLKTPMERLEGSGGKLTHVVTPKGKIEADTAIIVI
    GAKPNIEVALNSGLVIGETGGVKVDEYMFTSDPNILAAGDVAEVKDFVSGKPTLTGLASTALVQGRIAAENAAGGKTRYL
    GALSPFLVSVGDYFFGGVGLSATRADSLKMEYRAFRFSGSDLPKYMPGKENTVIWLITDRKGKLLGGQVFGRRGVRERIL
    FLTAAIYAGFNVEDIRIMEFAYQPEVCDVLEPIAIAAEGMFRKYMLGSEG

    >gi|170290838|ref|YP_001737654.1| glutaredoxin-like domain-containing protein [Candidatus Korarchaeum cryptofilum OPF8]
    MSSKGGRIIDEQTAAQLRARFESEMVRPVEILLLKGLGNEEYSEWTESLLLELGSLSDMIEVRVIDVKIDPEALEEFNVT
    RTPTILLDPRKGYKIRYMGAPLGYEAWAFVETIILLSRDESGLSERTKEILGSVRQFDHKDIHIMTFVTPT
    CPYCPYQVL
    LANKFAIELKGIIEADCIEAYENPDLADSYQVSAVPHNVILMREDGNEVILDTSVGSQPEEKYAMDLVRSLRSKHGK

    >gi|170290894|ref|YP_001737710.1| methylated-DNA--protein-cysteine methyltransferase [Candidatus Korarchaeum cryptofilum OPF8]
    MRVKYEIFSIGGSFIGIAEAEGTIYCNTIPLRGEKEAENDLIKNCRSAWPNLTLEKGSVNCGELPVKIYKIFSGENEDTS
    NIMLANHENIKFQEALEAISLIPRGTFTTYGELARLIATSPRAVGLYASKNPFPLIVP
    CHRVVRGDMRVGGYGYGEELKA
    LLLIREGIEVDLSRMRVNPNKLIRASDLRRMREVSGHASST

    >gi|170290595|ref|YP_001737411.1| hypothetical protein Kcr_0982 [Candidatus Korarchaeum cryptofilum OPF8]
    MSAKVSVYYTPECPADEFLKELRETLSEAGISCEIEEIVLASDDEAVEHKVLGVPTVRINGVDVDPNFEDKGIYRAACTR
    LYKWKGAVYSFPPKEMILEALKRLGVRK