Sulfolobus islandicus M 16 4 uid58841

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|238618500|ref|YP_002913325.1| protein of unknown function DUF255 [Sulfolobus islandicus M.16.4]
    MNERLRNSQSGYLRKAVNHPINWYTWSNEIFEIAKREDKPILIDVGAAWCHWCNVMDEDTYSNPEIVKIVNENFIPVKVD
    RDEMPDLDRLLQNAAMTITGESGWPLTIFMTPEGKVFFGGTYFPPEDKYGRIGFKKLLLEILRIWREDRNQIFSSSIDPN
    MLIARNTGGVLSSSVLDDAFSYITSYFDIEYGGLGFGAKFPHPFVDLLFLNYSATRGDDLGKKLGLFTLRKMYYGGIFDQ
    VGGGFHRYTVDREWKLPHFEKLLIDNAELIYDYFTYYTATNDIEILDALRNSVDFVLRELYMDGKGFANSLDADSEGMEG
    KYYTWTEDELKGALGNDYGIAIRVFDLKNTVEVEGRKVLLRTTELRELSKVTGLQANEIIEKVSEIRAKLLTYREQNRKM
    PYRDDSTYTYPNAKLTESILFSSLILNKGIEEAKLVLSKLGKSVSRRLDGGKAGLPEDYAAALLASISAYEVLSEEKYYD
    LAIELGRNIGGIRPNNFTDMPNESANSMYIRALFKLSLLSDEFKVDEGKIKPLIPSLTAENSQFIAGIVNTISSYINGMA
    HIVVVDEKDGLAERLHRTALLTYYPFKLIERVDDSRTDYVSSVIRAMIKYNAGKSRAYVCIGNTCSMPVSEEEKIKQLLK
    TKL

    >gi|238618529|ref|YP_002913354.1| thioredoxin [Sulfolobus islandicus M.16.4]
    MNDELNDPELQKILSKKANQILNSLKEKVEEPVKHLNSKNFEEFITKNKIAVVDFWAEWCAPCFILAPIIEELANDYPQV
    AFGKLNTEENQDIVMRYGIMSLPTVMFFKNGEPVDQILGAVPREEIEVRIKALLE

    >gi|238618547|ref|YP_002913372.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sulfolobus islandicus M.16.4]
    MNVGEEAPDFEAESTLGKIKLSDFRGKKVILYFYPKSFTSGCTRELQRFTELYDEFKKLNAEVIGVSVDKIDTQKKFAEK
    YGAKFPIVADAQKTISKLYSVLNERGTSAQRVTFIIDENGKIVDILKNLKKAEEHADKSLEIIKKQNST

    >gi|238618573|ref|YP_002913398.1| CoA-disulfide reductase [Sulfolobus islandicus M.16.4]
    MERLIIIGGGAAGMTAASWARRLKPNIDITVFESTKMVSHAPCGIPYFTEGLFDDENLFMTYTPEYFAEKRKINVKINSK
    VEEVDLRSRTITVRENQENKKYEFDYLLLSTGAKPKKLNAEGDRIFYVHHPADASYIRQKLWSFDRIAIIGGGILGIEMA
    EALRARGKKLVLIHRGKYLLNKMLDEDMGKIITDKVGSEIELKLNESLISVTERGRLIVTDKGKYEVDATVVGIGVEPNV
    DLVKDQLKIGETGAIWADNHMRTSFENVYAAGDSTESINIITKKPDWVPFAPVANKMGFVAGNNIGGKDVTFPGVIGTMI
    TKFEEYVIAKTGITENEAKRHNIKTVSATVHHKTRARYYPGSKDIIVKLIAEANTMRIIGAQIIGEEEVLGRLNMMAAVI
    QKGFTAEELFFVETGYVPPVNRVWDAITLAARKLYTGISGE

    >gi|238618705|ref|YP_002913530.1| thioredoxin reductase [Sulfolobus islandicus M.16.4]
    MSLLPRTASVKPGEKFDVIIVGLGPAAYGAALYTARYMLKTLVIGETPGGQLTEAGIVDDYLGLIEIQASDMIKVFNKHI
    EKYEVPVLLDIVEKIENRGDGFVVKTKRKGEFKADSVILGIGVKRRKLGVPGEQEFVGKGISY
    CSVCDAPLFKNRVVAVV
    GGGDSALEGAEILSSYSTKVYLIHRRDSFKAQPIYVETVKKKPNVEFVLNSVVKEIKGDKVVRQVVVENLKTGEIKELNV
    NGVFVEIGFDPPTDFAKSNGIETDTNGYIKVDEWMRTSVPGIFAAGDCTSMWLGFRQVITSVAQGAVAATSAYRYVTEKK
    GKK

    >gi|238618766|ref|YP_002913591.1| methylated-DNA--protein-cysteine methyltransferase [Sulfolobus islandicus M.16.4]
    MLVYGLYKSPLGYITVAKDDKGFIMLDFCDCVEGNSRDDSSFTEFFHKLDLYFEGKPINLREPINLKTYPFRLSVFKEVM
    KIPWGKVMTYKQIADSLGTSPRAVGMALSKNPILLIIP
    CHRVIAENGIGGYSRGVKLKRALLELEGVKIPE

    >gi|238618828|ref|YP_002913653.1| conserved hypothetical selenoprotein [Sulfolobus islandicus M.16.4]
    MQDPVCKMEVENTTPYRINYRGITYYFCSKGCLDEFKKNLTKYVSPADLNKKIDVKIVYCRPCKYMDRALNLARDILSYF
    EEVNVELVQGDRGILDIYVNDELVFSRYIEKRFPESEEILKSIGQKLQLARQS

    >gi|238618829|ref|YP_002913654.1| FAD-dependent pyridine nucleotide-disulphideoxido reductase [Sulfolobus islandicus M.16.4]
    MREKSCDYLIIGSGIAGYNALKELLELKPNSKIIMVSSDKYYPYDRPPLSKYYLRGEMAREKLFFESDDFYKRSNLDVVL
    NRSVERIDTISKEAILNDGSVISFDRALIASGGRPRRLSVPGGENALYLRTLDD
    CDGIREVASRSRNALIIGAGFIGVEV
    ASSLTTLGVRTTVVEVMPYIWNTFVDEKVSRVIRQYLEGKGINFILNESVREIQGKAAITSGGKRLEADMFLIAVGIVPN
    VEVAQKSGIQVDNGVIVNEYLETSAKDIYAAGDVANIFDPREGRRKRIEHWNNAEYTGKLAARNMAGNREAYNFISSIWS
    DIFDIHIESAGETRNYDEYVIRGRFNSDSPNFNVIYLKGGIVKGYVAINRDYGELEVLNKLIKEGKDVSNKKNSLADEGF
    DLKELLK

    >gi|238618848|ref|YP_002913673.1| putative peroxiredoxin [Sulfolobus islandicus M.16.4]
    MSEGRIPLIGEKFPEMEVITTHGKIKLPDDYKGRWFVLFSHPGDFTPVCTTEFYSFSKKYEEFKKLNTELIGLSVDSNIS
    HIEWVMWIEKNLKVEVPFPIIADPMGNVAKRLGMIHAESSTATVRAVFIIDDKGTVRLILYYPMEIGRNIDEILRAIRAL
    QLVDKAGVVTPANWPNNELIGDKVINPAPRTIKDAKMRLGQPFDWWFTYKEVKTT

    >gi|238619156|ref|YP_002913981.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sulfolobus islandicus M.16.4]
    MVKVGDKAPLFEGIADNGERISLSHFIGKHNIVLYFYPKDDTPGCTREACAFRDNWDLLKDYDVVVIGVSSDDINSHKKF
    KEKYKLPFILVSDPDKKIRELYGAKGFILPARITFVIDKKGIIRHIYNSQTNPANHVNEALKTLKQIKAEEIS

    >gi|238619313|ref|YP_002914138.1| FAD-dependent pyridine nucleotide-disulphideoxido reductase [Sulfolobus islandicus M.16.4]
    MKVVIIGAGPAGVYSALTLSKHAKVTLIEKEEKLGGTCVLYGCIPTKSILSQLIISRQASNMSLNTFREYALASINTISK
    SLEQLLNSHGIEVIHANGFLRSSMVHASNTSLTADKVLVSTGTRRERLGKVKFTEDLAYTNEDYNKVVIVGGDAGGIELA
    WMMKKLGKEVHLIDKNDLLLQNIDNTLSEVVTNFLSHIGIKLYLGKKVSKINETSVTLEDNQTISGDAVFVTFGRKPNIE
    GFEEIPHEKYIYVDEYLRTQIPNIYAAGDIIGTFTAHEAIYGGIIAAKNMLGEKREFLVEGIPKVIYIYPQIAYVGTTIG
    NCVTFNTLNLTRTVVEREGEGFLKICERDNRVIGGVAFMPYAEDVISLISVLIRYQINLKDTIDLVMPHPSYLEAITEAL
    NMLQSKE

    >gi|238619541|ref|YP_002914366.1| DsrE family protein [Sulfolobus islandicus M.16.4]
    MAQAQTQGQEEEQKKKILIVVTHGPEDLDRTYAPLFMASIAASMEYETSVFFMIKGPKLLDKKWQEEERKKGGNPFIHFF
    DMAKDNGVKMYV
    CVQSLKDMCHMKEDDVVEGIELVGGSTLIDLTMDADRTLFF

    >gi|238619542|ref|YP_002914367.1| FAD-dependent pyridine nucleotide-disulphideoxido reductase [Sulfolobus islandicus M.16.4]
    MKYDIVVIGGGTAGYVAGSILARKGKKVIVIEKEKFGGVCVNFGCVPSIFLFDVTFLLNRFKEIVYYLGLDGEIEYKDLL
    FSKRNEIVNYLSNAGRRLIEDSGGETELGEAEIISPSEVKVNGRIVEFDKLIIATGSKPMIPNIDGIEDAISEDDAVNLN
    FIPSSMVVIGGGYAGVEIAQIYSRLGSQVTLLSRSEILPTFPEDVRSVVKDSLEFDGVNVVENTRIVKLRDGKVITEKGE
    IEGNVIVYATGRRPQLPKGIEKLGLEIDECGINVDKYKQIKNNAYAIGDVINKERKTAHSAMFDALVASLHILKETTFIP
    PDNFKIPVVLYTDPQVGVIGDHKEAKKFSVFPFAAITRAIINGIKDGYVKIGINERNEIVFGEVIGDKAEELINILTLVV
    NNRMRIESLALMPFVHPSLSEAIVNAAKGFFDLDVDRYKSKDGKT

    >gi|238619544|ref|YP_002914369.1| glutaredoxin related protein [Sulfolobus islandicus M.16.4]
    MSYDYVIKEYLNAIKKGDITIQQCNGDDLFHEFKNYVKVETLDNCKKPLVKVKKGDRVYYTYYGIPIANELWPFLNSLVR
    ISNNVVNLDEKEMELARQVRGNVKLFVTPD
    CTKCPITAEFLYQVSQINENVKLEIYDATEYEEERDKYRILSVPKIIFNE
    KVEIPGGFPSTMILKMMLKALQSELR

    >gi|238619586|ref|YP_002914411.1| DSBA oxidoreductase [Sulfolobus islandicus M.16.4]
    MVVKITFFHDVLCPFCFVTSRRLRSVARKFNDEIVVKHKAFMIISSLDDLKAAAPTEEEARELFKQEFSIIKRYFPDYDP
    EKVIGKGKITWVWSLPPLMACKAAEYQRGDNGYWDYFDKAQERFFLEGENVNDDNVLIQIAEELGLDIEKFKEDFKSKKA
    RMSVYEDEAEAHAMGIRGVPALLVNDYWLIRGVQDEAYLESVIEDLLSNGGEPKKVKLKAYWEAT

    >gi|238619599|ref|YP_002914424.1| OsmC family protein [Sulfolobus islandicus M.16.4]
    MTTITFTAEGKLERDKVIVDLNGTEIRVGLLGSDNPTPEEFCLASAISCLILTVYYIAREKGVAINSIEGYIEGKMDTKG
    FQGFKEVPPGLLEVNYELIVDSKDTRISEILKEAEERCPMRDTLTRSVKVNINWKIKS

    >gi|238619639|ref|YP_002914465.1| Rhodanese domain protein [Sulfolobus islandicus M.16.4]
    MLVSVEWLNNNLKDVKVVEIGYNPQINYYEGHIPGAVLINWRDFLDDNSRDFASPGKLSKVLGNAGINNDDLIVLYSEMN
    NRYAFYVYWILKAYGHSNLAILNGGIYKWLKEGYPIESDGVVVNKKSEYKARKPDWSSRILVWELLSKLKEFVLIDSRSK
    EEYDGLTTAPPEHKCEQTQMSGHIPGAKNIPWTILLNEDETMKSRDELERIFSWLSKEDKIVVY
    CRTGARASVAWYALKE
    VLGFKLVRLYDGSWVEYGNMVGVPVEKSVSDRF

    >gi|238619642|ref|YP_002914468.1| FAD-dependent pyridine nucleotide-disulphideoxido reductase [Sulfolobus islandicus M.16.4]
    MILILGGGFAGVSAYNQNKENSLVVDRKDYFLLTPWIIDFICGMKKLEDIIVKYKKVILGNVQKIDFKNKKVILDNSKEL
    TYDKLIVSLGHHQNLPRLKGAKEYAHKIETLEDAIELKRRLNEVKDITIIGGGATGVELAGNIKGKKISLVQRRNRLLPT
    MSTASSKKAEDLLRELGVNLMLGVEAIEIKKDSVVTSYGEIKTELTIFAGGLKGPQIVGNLHANKNHRLLVDKNLKSIEY
    NDVYGAGDCVTFEDKEIPMTADIAVAAGRVVMKNILGNEIEFKPKRLATTIRIRNEFFGDFGENYVEGKFAKILKDISYL
    ESLLLPRRLRE

    >gi|238620227|ref|YP_002915053.1| thioredoxin [Sulfolobus islandicus M.16.4]
    MSEIDSLIREVAERLQKKAEEYGKKKEDATLVLTEENFDEVIRNNKLVLVDCWAEWCAPCHLYEPIYKKVAEKYKGKAVF
    GRLNVDENQKIADKYSVLNIPTTLIFVNGQLVDSLVGAVDEDTLESTINKYLE

    >gi|238620281|ref|YP_002915107.1| hypothetical protein M164_1836 [Sulfolobus islandicus M.16.4]
    MEVQIFTHKNCVECNMLLEYLENKGLLGKVKIIDTELYPFLAFERGVISTPSIFIDGKLVYAGIVDFEEFERILSGEKVT
    RQIDKDKLVEKLMLGIVDSFAATAWLYINRDFDSFLAQKDFVMAVTGLSLLDEKEREEYYNYLRNIMIKEGEKYLEEWKP
    RMLRNISSNFIREIFWLYETKISKEVVMQKYPVEVFAHWLMVRGGAVGRVGLRIYPLSDSTLMRRVLEAYNFMLENYDDI
    FNKVQKEQTELKAKNREQVRYLQI

    >gi|238620295|ref|YP_002915121.1| UBA/THIF-type NAD/FAD binding protein [Sulfolobus islandicus M.16.4]
    MITFLLAFSATCLNLSNSSIDIGVPSLPPPFSIGTISIPTFSRQHLFLKIILHYNLVERYSRQLLVLGLGVQQRLNELKI
    LIAGCGALGSAIAELLARLGVGEITVVDADVVDVTNLHRVHLFDENDVGKPKAEICAKKLSLINSSIKINYIIDILDEQN
    VEKLISDKDYVFDALDSLYYKLLLNDATVKLRKILIYGGINGEYGSVKLIDSNQTSCLSCFINYSDQDEIGNS
    CDVIGTT
    PLIVELTATLQVNLMLNHLRGNPDYSLFYIDSRELKIERINIEKNFQCKTCVLNEYPFLNQKITKPNCGIFRVNMKVTEL
    DKPKVFKNIGNAILCYPNIGCFEKRGR

    >gi|238620395|ref|YP_002915221.1| glutaredoxin-like domain protein [Sulfolobus islandicus M.16.4]
    MEQEYAELFSDEVKNALQDALKDMRNPVDVYVFVDSEDSNCQYCSVTTKFLEFIASAAPKDGNGSLLKVHIVDRVNQNDR
    KIFEEFNVERVPTVAFYNGYIRWTGAPLGEEIRALVETIVRLSQGESGLSQETVEAIKSKLNGKVKIETVVTPS
    CPYCPY
    AALMAHMVAFEACRAGKCNVVSDVVEAYENQDIAEKYQVMSVPSIAINESVEFIGVPYEENFINAILEKQKIS

    >gi|238620720|ref|YP_002915546.1| protein of unknown function DUF395 YeeE/YedE [Sulfolobus islandicus M.16.4]
    MPSMVLQPVLQESWALIYGLFALSGFILGWAAQRGNYCFVNAMTSIFTAKSYERFGALLILFGLSALGSGLLVAFGVIPA
    FDQYYYNYFAGWYILVGSIIFGFGAALAGGCNLSMLYRAASGYVQNWIELFGMMIGTYVFAIGIWPFQLYTMANGILSTT
    NGGYVEYLPYIIFHSISNMSVYITTLVVSLPLIFIGIYLQQYTKRKWAISSSLRINLPAARAYYNQNISTSGEEKVSLTK
    EIKDLILLRKPYGTNLTTIILALDLLLVFIVGAGYTFNYLVITSSDGGRFFEYLLMLGNVKLFLNTPWFNDSLPIVDPST
    LMVIMLCIGAFSASYLSGDFKIRIPRNKSRLLIGFGGGMLVGIGVRMALG
    CNVGLMWTNFAQLGYDGIIFLFGMLLGVYL
    AIKVQERWL

    >gi|238620864|ref|YP_002915690.1| Rhodanese domain protein [Sulfolobus islandicus M.16.4]
    MSQVQEQQVIVDNKWVLDHLKDQKVRIVEVDYDPNTAYNVWHIPGAVLVRWREDLRHPVLRDFIEPSQFEKLMESKGISN
    NTTIVLYGDYNNWFAVYAFWLFKSYGHDDVRILNGGRTKWAKENLPTEQGAKEPQYPKGSYKVKKVDWGSHRAFFWEVLQ
    KITKGEVGRTTILVDVRSPKEYTGEIRAPPEYADEQTQVGGHIPGAVSFPWAQAVNPDTGEFKSIEELRRLVENAGITPE
    KEIITY
    CRIGERASHTWFVLKYLLGYPAVRVYDGSWAEWGNIVGAPVKKGTEP

    >gi|238620976|ref|YP_002915802.1| FAD-dependent pyridine nucleotide-disulphideoxido reductase [Sulfolobus islandicus M.16.4]
    MPLKTFDTIIVGAGIAGLSAALYSSRQKLSTLVLSKDLGGQLTLTDLIENYPGIESTGGLSLAQKIEKQAKKFGAEFIYG
    EEVKEIAQESDVFIIKGIKGEYAGRAIILAFGKTPREINVPGEQEFKGKGVSY
    CAICDAAFFKGKPAAVVGEGEPGIEAI
    ELLSNYANPAYYITSSSYLAGEEEIVKNVLNKPNVKIFTSSKVLEIRGNSKVEEIMIKKGDEIISLRVDGVIIEMGYVLK
    TEFLKGFVELNEKGEIVVDELGRTSREGVFAAGDVTQTPYKQAVVAAAEGVKAALSAYNYIRSKKGLPPVNVDWKAEKKK
    ISFRL

    >gi|238621044|ref|YP_002915870.1| mercuric reductase [Sulfolobus islandicus M.16.4]
    MEDLVIIGYGAAGFAALIRANQLGIKPVVVGYGEIGGTCVNVGCVPSKRMLRIGELYNNSSKIVGKKLFPEFFQAFQDKA
    EIVNSLRKEKYEDVINSYDVKLIIGKAHFISPNAIKVNGETIEAKKFIIATGSSPNVPNINGLTEVGFWTNVEALSPDKT
    ISSLAIIGGRALALEFAQMYKRLGVDTIILQRSERILPDWEPEISLSVKNYLEKNDNIPIFTNVRVKEVRKGNGGKIVVT
    DKGEVEADEILLATGRKPNVEMNLDAAGIELNDKGGIKVNEELRTSNPNVYAAGDVIGGPMLEALAGRQGSIAAENAIMN
    VKRKIDMSSVPQVVFIEPNVAKVGLTALEAMKEGYDIDHRVVKMNNIAKARILREDYGLIKMVIDKKFRNILGVQMFGKY
    AAEVINEAALAVKFRATIDDLIDTIHVFPTMAESLRIVALAFTSDVSKMSC
    CV

    >gi|238621082|ref|YP_002915908.1| heavy metal translocating P-type ATPase [Sulfolobus islandicus M.16.4]
    MVTEKKEELRITDKEEQLKIVGMHCATCVMSVSKSLKSVSGVKDAEVNLATGSAKVILSGNVRLKELVKAVRKAGYDVAT
    EKFTIKLNVNPEEMPKIERKFENVKGVVDVKSNPGLGIVSVEYNPESTTPEEILKEAGVKGEIINEQRSERSILYKDFYD
    LLKRLVIGITFTPLTYLFPFFLGILLSIPIQFYSGLRFHKGAYRALKNRTTNMDVLVSLASNILWFSGIFLHSTFYADAS
    LLITFILVGKTLEAYIKAKMSSEIRIEPYKATLKDGRVVNSNELKVGDIVIVRTGERIPADGIIESGEGEVNEAIITGEQ
    KPVLKRKGDNVLAGGILVNGYLEIYVTRNWDRSYIIQVIESVRGAYNARVSIQNLVDKVSSVFVPIVITLSALTFLVWKF
    VLGYNLYSSLFFSVAVLAAACPCALGLASPMAMLVSVRRALKRGIIIRDGSILEEIRNVNVAVLDKTGTVTEGEYVIVSK
    KEFINGALDLAAIAESRSIHPIAKAFHKMNMKDGKVEQFEEFPGRGIYARINGNDVIVGSKDFVKSNCDWNVEDEGDILV
    CINGRAGGIVNIRDKLRDDAKRVINYMKERGIMVIIATGDSSNYADEIGKELGIEVRKGLTPDNKAELVKELRENGNKVM
    FIGDGINDAIAMREADVGIAISSGTDLAKSAGKVVINSLDDVIGLFEQAKLGVRKIKENLAWAFGYNTVIIPIAAGLFYP
    TIYLPPEYAALAMGFSSVIVSLWSLVPI

    >gi|238621096|ref|YP_002915922.1| Rhodanese domain protein [Sulfolobus islandicus M.16.4]
    MMLITERRSPFYPNIQNVPPSVIRKLVKNKEIQLIDIRQPWEYEDHHIPGSILLPLDYFEDLFQLMLNKSNIGIICEHAN
    RSTWLVYTKPSLFKEVKVYNMLGGIELWMMMGYEVEKGMDDNGTLWYKLLTKNLR

    >gi|238621118|ref|YP_002915944.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sulfolobus islandicus M.16.4]
    MVEIGQKAPELELVDTDLKKVKIPSDFKGKVVVLAFYPAAFTSVCTKEMCTFRDSMAKFNEVNAVVIGVSVDPPFSNKAF
    KEQNKLNFTIVSDFNREAVKAYGVAGELPILKGYVLAKRSVFVIDKNGIIRYKWVSEDPTKEPNYDEIKDVISKLS

    >gi|238621162|ref|YP_002915988.1| FAD-dependent pyridine nucleotide-disulphideoxido reductase [Sulfolobus islandicus M.16.4]
    MPKSIIFLMKVAVIGSGPAGIDASLELAKNNKVILVEKEERLGGTCVLYGCIPSKAMLHPIHLASELEKLGKSIVFDLGE
    LRKLGQEASFRLSKGVEYMLEDNGVEVIYGVASLRSGQLNVNNETLQADYIVLATGTYREVVKGIIYSEDLPYLDKDFQS
    VVIVGGDVGGVEFGWMLRKLGKEVVLIDKQSSLLPYLDKEVSNAITNYFSKIGVKLYLNRSVKEMKEREVVLENGERLTA
    DVVYMTFGRKPSIQGFEEVNHNPFVTVDEYLRTSISNVFAAGDIIGTHTAHEAMYAGKVAAINVMGGKKVFNKQGIPKVV
    YTHPTIAYVGSMEGKCAKINLAEIGRAITEKETDGFLKICVKDDKIVGAQAFMKDAEEVISLISFLIRYNIKVSEIKDYV
    APHPSYIEAITELISRL

    >gi|238621182|ref|YP_002916008.1| Rhodanese domain protein [Sulfolobus islandicus M.16.4]
    MTQVIESYSSPFYKNIIDLPPSMVRKLWKSGKIIILDIRTPQEYEDHHIPGAILAPLNYLEHLTELFEDREVAVVCEHGN
    RASYATYGMPHLYKKKAYYMIGGMALWMAMGYEVESGMDENGVLWQKILEKKFNY