Sulfolobus islandicus M 16 27 uid58851

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|229583594|ref|YP_002842095.1| protein of unknown function DUF255 [Sulfolobus islandicus M.16.27]
    MNERLRNSQSGYLRKAVNHPINWYTWSNEIFEIAKSEDKPILIDVGAAWCHWCNVMDEDTYSNPEIVKIVNENFIPVKVD
    RDEMPDLDRLLQNAAMTITGESGWPLTIFMTPEGKVFFGGTYFPPEDKYGRIGFKKLLLEILRIWREDRNQIFSSSIDPN
    MLIARNTGGVLSSSVLDDAFSYITSYFDIEYGGLGFGAKFPHPFVDLLFLNYSATRGDDLGKKLGLFTLRKMYYGGIFDQ
    VGGGFHRYTVDREWKLPHFEKLLIDNAELIYDYFTYYTATNDIEILDALRNSVDFVLRELYMDGKGFANSLDADSEGMEG
    KYYTWTEDELKGALGNDYGIAIRVFDLKNTVEVEGRKVLLRTTELRELSKVTGLQANEIIEKVSEIRAKLLTYREQNRKM
    PYRDDSTYTYPNAKLTESILFSSLILNKGIEEAKLVLSKLGKSVSRRLDGGKAGLPEDYAAALLASISAYEVLSEEKYYD
    LAIELGRNIGGIRPNNFTDMPNESANSMYIRALFKLSLLSDEFKVDEGKIKPLIPSLTAENSQFIAGIVNTISSYINGMA
    HIVVVDEKDGLAERLHRTALLTYYPFKLIERVDDSRTDYVSSVIRAMIKYNAGKSRAYVCIGNTCSMPVSEEEKIKQLLK
    TKL

    >gi|229583623|ref|YP_002842124.1| thioredoxin [Sulfolobus islandicus M.16.27]
    MNDELNDPELQKILSKKANQILNSLKEKVEEPVKHLNSKNFEEFITKNKIAVVDFWAEWCAPCFILAPIIEELANDYPQV
    AFGKLNTEENQDIVMRYGIMSLPTVMFFKNGEPVDQILGAVPREEIEVRIKALLE

    >gi|229583641|ref|YP_002842142.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sulfolobus islandicus M.16.27]
    MNVGEEAPDFEAESTLGKIKLSDFRGKKVILYFYPKSFTSGCTRELQRFTELYDEFKKLNAEVIGVSVDKIDTQKKFAEK
    YGAKFPIVADAQKTISKLYSVLNERGTSAQRVTFIIDENGKIVDILKNLKKAEEHADKSLEIIKKQNST

    >gi|229583667|ref|YP_002842168.1| CoA-disulfide reductase [Sulfolobus islandicus M.16.27]
    MERLIIIGGGAAGMTAASWARRLKPNIDITVFESTKMVSHAPCGIPYFTEGLFDDENLFMTYTPEYFAEKRKINVKINSK
    VEEVDLRSRTITVRENQENKKYEFDYLLLSTGAKPKKLNAEGDRIFYVHHPADASYIRQKLWSFDRIAIIGGGILGIEMA
    EALRARGKKLVLIHRGKYLLNKMLDEDMGKIITDKVGSEIELKLNESLISVTERGRLIVTDKGKYEVDATVVGIGVEPNV
    DLVKDQLKIGETGAIWADNHMRTSFENVYAAGDSTESINIITKKPDWVPFAPVANKMGFVAGNNIGGKDVTFPGVIGTMI
    TKFEEYVIAKTGITENEAKRHNIKTVSATVHHKTRARYYPGSKDIIVKLIAEANTMRIIGAQIIGEEEVLGRLNMMAAVI
    QKGFTAEELFFVETGYVPPVNRVWDAITLAARKLYTGISGE

    >gi|229583782|ref|YP_002842283.1| thioredoxin reductase [Sulfolobus islandicus M.16.27]
    MSLLPRTASVKPGEKFDVIIVGLGPAAYGAALYTARYMLKTLVIGETPGGQLTEAGIVDDYLGLIEIQASDMIKVFNKHI
    EKYEVPVLLDIVEKIENRGDGFVVKTKRKGEFKADSVILGIGVKRRKLGVPGEQEFVGKGISY
    CSVCDAPLFKNRVVAVV
    GGGDSALEGAEILSSYSTKVYLIHRRDSFKAQPIYVETVKKKPNVEFVLNSVVKEIKGDKVVRQVVVENLKTGEIKELNV
    NGVFVEIGFDPPTDFAKSNGIETDTNGYIKVDEWMRTSVPGIFAAGDCTSMWLGFRQVITSVAQGAVAATSAYRYVTEKK
    GKK

    >gi|229583843|ref|YP_002842344.1| methylated-DNA--protein-cysteine methyltransferase [Sulfolobus islandicus M.16.27]
    MLVYGLYKSPLGYITVAKDDKGFIMLDFCDCVEGNSRDDSSFTEFFHKLDLYFEGKPINLREPINLKTYPFRLSVFKEVM
    RIPWGKVMTYKQIADSLGTSPRAVGMALSKNPILLIIP
    CHRVIAENGIGGYSRGVKLKRALLELEGVKIPE

    >gi|229583899|ref|YP_002842400.1| conserved hypothetical selenoprotein [Sulfolobus islandicus M.16.27]
    MQDPVCKMEVENTTPYRINYRGITYYFCSKGCLDEFKKNLTKYVSPADLNKKIDVKIVYCRPCKYMDRALNLARDILSYF
    EEVNVELVQGDRGILDIYVNDELVFSRYIEKRFPESEEILKSIGQKLQLARQS

    >gi|229583900|ref|YP_002842401.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Sulfolobus islandicus M.16.27]
    MREKSCDYLIIGSGIAGYNALKELLELKPNSKIIMVSSDKYYPYDRPPLSKYYLRGEMAREKLFFESDDFYKRSNLDVVL
    NRNVERIDTISKEAILNDGSVISFDRALIASGGRPRRLSVPGGENALYLRTLDD
    CDGIREVASRSRNALIIGAGFIGVEV
    ASSLTTLGVRTTVVEVMPYIWNTFVDEKVSRVIRQYLEGKGINFILNESVREIQGKAAITSGGKRLEADMFLIAVGIVPN
    VEVAQKSGIQVDNGVIVNEYLETSAKDIYAAGDVASIFDPREGRRKRIEHWNNAEYTGKLAARNMAGNREAYNFISSIWS
    DIFDIHIESAGETRNYDEYVIRGRFNSDSPNFNVIYLKGGIVKGYVAINRDYGELEVLNKLIKEGKDVSNKKNSLADEGF
    DLKELLK

    >gi|229583916|ref|YP_002842417.1| putative peroxiredoxin [Sulfolobus islandicus M.16.27]
    MSEGRIPLIGEKFPEMEVITTHGKIKLPDDYKGRWFVLFSHPGDFTPVCTTEFYSFSKKYEEFKKLNTELIGLSVDSNIS
    HIEWVMWIEKNLKVEVPFPIIADPMGNVAKRLGMIHAESSTATVRAVFIIDDKGTVRLILYYPMEIGRNIDEILRAIRAL
    QLVDKAGVVTPANWPNNELIGDKVINPAPRTIKDAKMRLGQPFDWWFTYKEVKTT

    >gi|229584181|ref|YP_002842682.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sulfolobus islandicus M.16.27]
    MVKVGDKAPLFEGIADNGERISLSHFIGKHNIVLYFYPKDDTPGCTREACAFRDNWDLLKDYDVVVIGVSSDDINSHKKF
    KEKYKLPFILVSDPDKKIRELYGAKGFILPARITFVIDKKGIIRHIYNSQTNPANHVNEALKTLKQIKAEEIS

    >gi|229584336|ref|YP_002842837.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Sulfolobus islandicus M.16.27]
    MKVVIIGAGPAGVYSALTLSKHAKVTLIEKEEKLGGTCVLYGCIPTKSILSQLIISRQASNMSLNTFREYALASINTISK
    SLEQLLNSHGIEVIHANGFLRSSMVHASNTSLTADKVLVSTGTRRERLGKVKFTEDLAYTNEDYNKVVIVGGDAGGIELA
    WMMKKLGKEVHLIDKNDLLLQNIDNTLSEIVTNFLSRIGIKLYLGKKVSKIDETSVTLEDNQTISGDAVFVTFGRKPNIE
    GFEEIPHEKYIYVDEYLRTQIPNIYAAGDIIGTFTAHEAIYGGIIAAKNMLGEKREFLVEGIPKVIYIYPQIAYVGTTIG
    NCVTFNTSNLTRTVLEREGEGFLKICERDNRVIGGVAFMPYAEDVISLISVLIRYQINLKDTIDIVMPHPSYLEAITEAL
    NMLQSKE

    >gi|229584600|ref|YP_002843101.1| DsrE family protein [Sulfolobus islandicus M.16.27]
    MAQAQTQGQEEEQKKKILIVVTHGPEDLDRTYAPLFMASIAASMEYETSVFFMIKGPKLLDKKWQEEERKKGGNPFIHFF
    DMAKDNGVKMYV
    CVQSLKDMCHMKEDDVVEGIELVGGSTLIDLTMDADRTLFF

    >gi|229584601|ref|YP_002843102.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Sulfolobus islandicus M.16.27]
    MKYDIVVIGGGTAGYVAGSILARKGKKVIVIEKEKFGGVCVNFGCVPSIFLFDVTFLLNRFKEIVYYLGLDGEIEYKDLL
    FSKRNEIVNYLSNAGRRLIEDSDGETELGEAEIISPSEVKVNGRIVEFDKLIIATGSKPMIPNIDGIEDAISEDDAVNLN
    FIPSSMVVIGGGYAGVEIAQIYSRLGSQVTLLSRSEILPTFPEDVRSVVKDSLEFDGVNVVENTRIVKLRDGKVITEKGE
    IEGNVIVYATGRRPQLPKGIEKLGLEIDECGINVDKYKQIKNNAYAIGDVINKERKTAHSAMFDALVASLHILKETTFIP
    PDNFKIPVVLYTDPQVGVIGDHKEAKKFSVFPFAAITRAIINGIKDGYVKIGINERNEIVFGEVIGDKAEELINILTLVV
    NNRMRIESLALMPFVHPSLSEAIVNAAKGFFDLDVDRYKSKDGKT

    >gi|229584603|ref|YP_002843104.1| glutaredoxin related protein [Sulfolobus islandicus M.16.27]
    MSYDYVIKEYLNAIKKGDITIQQCNGDDLFHEFKNYVKVETLDNCKKPLVKVKKGHRVYYTYYGIPIANELWPFLNSLVR
    ISNNVVNLDEKEMELARQVRGNVKLFVTPD
    CTKCPITAEFLYQVSQINENVKLEIYDTTEYEEERDKYRILSVPKIIFNE
    KVEIPGGFPSTMILKMMLKALQSELR

    >gi|229584645|ref|YP_002843146.1| DSBA oxidoreductase [Sulfolobus islandicus M.16.27]
    MVVKITFFHDVLCPFCFVTSRRLRSVARKFNDEIVVKHKAFMIISSLDDLKAAAPTEEEARELFKQEFSIIKRYFPDYEP
    EKVIGKGKITWVWSLPPLMACKAAEYQRGDNGYWDYFDKAQERFFLEGENVNDDNVLIQIAEELGLDIEKFKEDFKSKKA
    RMSVYEDEAEAHAMGIRGVPALLVNDYWLIRGVQDEAYLESVVEDLLSNGGEPKKVKLKAYWEAT

    >gi|229584658|ref|YP_002843159.1| OsmC family protein [Sulfolobus islandicus M.16.27]
    MTTITFTAEGKLERDKVIVDLNGTEIRVGLLGSDNPTPEEFCLASAISCLILTMYYIAREKGVAINSIEGYIEGKMDTKG
    FQGFKEVPPGLLEVNYELIVDSKDTRISEILKEAEER
    CPMRDTLTRSVKVNINWKIKS

    >gi|229584697|ref|YP_002843199.1| Rhodanese domain protein [Sulfolobus islandicus M.16.27]
    MLVSVEWLNNNLKDVKVVEIGYNPQINYYEGHIPGAVLINWRDFLDDNSRDFASPGKLSKVLGNAGINNDDLIVLYSEMN
    NRYAFYVYWILKAYGHSNLAILNGGIYKWLKEGYPIESDGIVVNKKSEYKARKPDWSSRILVWELLSKLKEFVLIDSRSK
    EEYNGLTTAPPEHKCEQTQMSGHIPGAKNIPWTILLNEDETMKSRDELERIFSWLSKEDKIVVY
    CRTGARASVAWYALKE
    VLGFKLVRLYDGSWVEYGNMVGVPVEKSVSDRF

    >gi|229584700|ref|YP_002843202.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Sulfolobus islandicus M.16.27]
    MILILGGGFAGVSAYNQNKENSLVVDRKDYFLLTPWIIDFICGMKKLEDIIVKYKKVILGNVQKIDFKNKKVILDNSKEL
    TYDKLIVSLGHHQNLPRLKGAKEYAHKIETLEDAIELKRRLNEVKDITIIGGGATGVELAGNIKGKKISLVQRRNRLLPT
    MSTASSKKAEDLLRELGVNLMLGVEAIEIKKDSVVTSYGEIKTELTIFAGGLKGPQIVGNLHANKNHRLLVDKNLKSIEY
    NDVYGAGDCVTFEDKEIPMTADIAVAAGRVVMKNILGNEIEFKPKRLATTIRIRNEFFGDFGENYVEGKFAKILKDISYL
    ESLLLPRRLRE

    >gi|229585268|ref|YP_002843770.1| thioredoxin [Sulfolobus islandicus M.16.27]
    MSEIDSLIREVAERLQKKAEEYGKKKEDATLVLTEENFDEVIRNNKLVLVDCWAEWCAPCHLYEPIYKKVAEKYKGKAVF
    GRLNVDENQKIADKYSVLNIPTTLIFVNGQLVDSLVGAVDEDTLESTINKYLE

    >gi|229585320|ref|YP_002843822.1| hypothetical protein M1627_1906 [Sulfolobus islandicus M.16.27]
    MEVQIFTHKNCVECNMLLEYLENKGLLGKVKIIDTELYPFLAFERGVISTPSIFIDGKLVYAGIVDFEEFERILSGEKVT
    RQIDKDKLVEKLMLGIVDSFAATAWLYINRDFDSFLAQKDFVMAVTGLSLLDEKEREEYYNYLRNIMIKEGEKYLEEWKP
    RMLRNISSNFIREIFWLYETKISKEVVMQKYPVEVFAHWLMVRGGAVGRVGLRIYPLSDSTLMRRVLEAYNFMLGNYDDI
    FNKVQKEQTELKAKNREQVRYLQI

    >gi|229585334|ref|YP_002843836.1| UBA/THIF-type NAD/FAD binding protein [Sulfolobus islandicus M.16.27]
    MITFLLAFSATCLNLSNSSIDIGVPSLPPPFSIGTISIPTFSRQHLFLKIILHYNLVERYSRQLLVLGLGVQQRLNELKI
    LIAGCGALGSAIAELLARLGVGEITVVDADVVDVTNLHRVHLFDENDVGKPKAEICAKKLSLINSSIKINYIIDILDEQN
    VEKLISDKDYVFDALDSLYYKLLLNDATVKLRKILIYGGINGEYGSVKLIDSNQTSCLSCFINYSDQDEIGNS
    CDVIGTT
    PLIVELTATLQVNLMLNHLRGNPDYSLFYIDSRELKIERINIEKNFQCKTCVLNEYPFLNQKITKPNCGIFRVNMKVTEL
    DKPKVFKNIGNAILCYPNIGCFEKRGR

    >gi|229585433|ref|YP_002843935.1| glutaredoxin-like domain protein [Sulfolobus islandicus M.16.27]
    MEQEYAELFSDEVKNALQDALKDMRNPVDVYVFVDSEDSNCQYCSVTTKFLEFIASAAPKDGNGSLLKVHIVDRVNQNDR
    KIFEEFNVERVPTVAFYNGYIRWTGAPLGEEIRALVETIVRLSQGESGLSQETVEAIKSKLNGKVKIETVVTPS
    CPYCPY
    AALMAHMVAFEACRAGKCNVVSDVVEAYENQDIAEKYQVMSVPSIAINESVEFIGVPYEENFINAILEKQKIS

    >gi|229585756|ref|YP_002844258.1| protein of unknown function DUF395 YeeE/YedE [Sulfolobus islandicus M.16.27]
    MPSMVLQPVLQESWALIYGLFALSGFILGWAAQRGNYCFVNAMTSIFTAKSYERFGALLILFGLSALGTGLLVAFGVIPA
    FDQYYYNYFAGWYILVGSIIFGFGAALAGG
    CNLSMLYRAASGYVQNWIELFGMMIGTYVFAIGIWPFQLYTMANGILSTT
    NGGYVEYLPYIIFHSISNMSVYITTLVVSLPLIFIGIYLQQYTKRKWAISSSLRINLPAARAYYNQNISTSGEEKVSLTK
    EIKDLILLRKPYGTNLTTIILALDLLLVFIVGAGYTFNYLVITSSDGGRFFEYLLMLGNVKLFLNTPWFNDSLPIVDPST
    LMVIMLCIGAFSASYLSGDFKIRIPRNKSRLLIGFGGGMLVGIGVRMALG
    CNVGLMWTNFAQLGYDGIIFLFGMLLGVYL
    AIKVQERWL

    >gi|229585889|ref|YP_002844391.1| Rhodanese domain protein [Sulfolobus islandicus M.16.27]
    MSQVQEQQVIVDNKWVLDHLKDQKVRIVEVDYDPNTAYNVWHIPGAVLVRWREDLRHPVLRDFIEPSQFEKLMESKGISN
    NTTIVLYGDYNNWFAVYAFWLFKSYGHDDVRILNGGRTKWAKENLPTEQGAKEPQYPKGSYKVKKVDWGSHRAFFWEVLQ
    KITKGEVGRTTILVDVRSPKEYTGEIRAPPEYADEQTQVGGHIPGAVSFPWVQAVNPDTGEFKSIEELRRLVESAGITPE
    KEIITY
    CRIGERASHTWFVLKYLLGYPAVRVYDGSWAEWGNIVGAPVKKGTEP

    >gi|229585991|ref|YP_002844493.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Sulfolobus islandicus M.16.27]
    MPLKTFDTIIVGAGIAGLSAALYSSRQKLSTLVLSKDLGGQLTLTDLIENYPGIESTGGLSLAQKIEKQAKKFGAEFIYG
    EEVKEIAQESDVFIIKGIKGEYAGRAIILAFGKTPREINVLGEQEFKGKGVSY
    CAICDAAFFKGKPAAVVGEGEPGIEAI
    ELLSNYANPAYYITSSSYLAGEEEIVKNVLNKPNVKIFTSSKVLEIRGNSKVEEIMIKKGDEIISLRVDGVIIEMGYVLK
    TEFLKGFVELNEKGEIVVDELGRTSREGVFAAGDVTQTPYKQAVVAAAEGVKAALSAYNYIRSKKGLPPVNVDWKAEKKK
    ISFRL

    >gi|229586059|ref|YP_002844561.1| mercuric reductase [Sulfolobus islandicus M.16.27]
    MEDLVIIGYGAAGFAALIRANQLGIKPVVVGYGEIGGTCVNVGCVPSKRMLRIGELYNNSSKIVGKKLFPEFFQAFQDKA
    EIVNSLRKEKYEDVINSYDVKLIIGKAHFISPNAIKVNGETIEAKKFIIATGSSPNVPNINGLTEVGFWTNVEALSPDKT
    ISSLAIIGGRALALEFAQMYKRLGVDTIILQRSERILPDWEPEISLSVKNYLEKNDNIPIFTNVRVKEVRKGNGGKIVVT
    DNGEVEADEILLATGRKPNVDMNLDAAGIELNDKGGIKVNEELRTSNPNVYAAGDVIGGPMLEALAGRQGSIAAENAIMN
    VKRKIDMSSVPQVVFIEPNVAKVGLTALEAMKEGYDIDHRVVKMNNIAKARILREDYGLIKMVIDKKFRNILGVQMFGKY
    AAEVINEAALAVKFRATIDDLIDTIHVFPTMAESLRIVALAFTSDVSKMSC
    CV

    >gi|229586097|ref|YP_002844599.1| heavy metal translocating P-type ATPase [Sulfolobus islandicus M.16.27]
    MVTEKKEELRITDKEEQLKIIGMHCATCVMSVSKSLKSVSGVKDAEVNLATGSAKVILSGNVRLKELVKAVRKAGYDVAT
    EKFTIKLNVNPEEMPKIERKFENVKGVVDVKSNPGLGIVSVEYNPESTTPEEILKEAGVKGEIINEQRSERSILYKDFYD
    LLKRLVIGITFTPLTYLFPFFLGILLSIPIQFYSGLRFHKGAYRALKNRTTNMDVLVSLASNILWFSGIFLHSTFYTDAS
    LLITFILVGKTLEAYIKAKMSSEIRIEPYKATLKDGRVVNSNELKVGDIVIVRTGERIPADGIIESGEGEVNEAIITGEQ
    KPVLKRKGDNVLAGGILVNGYLEIYVTRNWDRSYIIQVIESARGAYNARVSIQNLVDKVSSVFVPIVITLSALTFLVWKF
    VLGYNLYSSLFFSVAVLAAACPCALGLASPMAMLVSVRRALKRGIIIRDGSILEEIRNVNVAVLDKTGTVTEGEYVIVSK
    KEFINGALDLAAIAESRSIHPIAKAFHKMNMKDGKVEQFEEFPGRGIYARINGNDVIVGSKDFVKSNCDWNVEDEGDILV
    CINGRAGGIVNIRDKLRDDAKRVINYMKERGIMVIIATGDSSNYADEIGKELGIEVRKGLTPDNKAELVKELRENGNKVM
    FIGDGINDAIAMREADVGIAISSGTDLAKSAGKVVINSLDDVIGLFEQAKLGVRKIKENLAWAFGYNTVIIPIAAGLFYP
    TIYLPPEYAALAMGFSSVIVSLWSLVPI

    >gi|229586111|ref|YP_002844613.1| Rhodanese domain protein [Sulfolobus islandicus M.16.27]
    MMLITERRSPFYPNIQNVPPSVIRKLVKNKEIQLIDIRQPWEYEDHHIPGSILLPLDYFEDLFQLMLNKSNIGIICEHAN
    RSTWLVYTKPSLFKEVKVYNMLGGIELWMMMGYEVEKGMDNNGTLWYKLLTKNLR

    >gi|229586133|ref|YP_002844635.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sulfolobus islandicus M.16.27]
    MVEIGQKAPELELVDTDLKKVKIPSDFKGKVVVLAFYPAAFTSVCTKEMCTFRDSMAKFNEVNAVVIGVSVDPPFSNKAF
    KEQNKLNFTIVSDFNREAVKAYGVAGELPILKGYVLAKRSVFVIDKNGIIRYKWVSEDPTKEPNYDEIKDVISKLS

    >gi|229586177|ref|YP_002844679.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Sulfolobus islandicus M.16.27]
    MPKSIIFLMKVAVIGSGPAGIDASLELAKNNKVILVEKEERLGGTCVLYGCIPSKAMLHPIHLASELEKLGKSIVFDLGE
    LRKLGQEASFRLSKGVEYMLEDNGVEVIYGIASLRSGQLNVNNETLQADYIVLATGTYREVVKGIIYSEDLPYLDKDFQS
    VVIVGGDVGGVEFGWMLRKLGKEVVLIDKQSSLLPYLDKEVSNAITNYFSKIGVKLYLNRSVKEMKEREVVLENGERLTA
    DVVYMTFGRKPSIQGFEEVNHNPFVTVDEYLRTSISNVFAAGDIIGTHTAHEAMYAGKVAAINVMGGKKVFNKQGIPKVV
    YTHPTIAYVGSMEGKCAKINLAEIGRAITEKETDGFLKICVKDDKIVGAQAFMKDAEEVISLISFLIRYNIKVSEIKDYV
    APHPSYIEAITELISRL

    >gi|229586198|ref|YP_002844700.1| Rhodanese domain protein [Sulfolobus islandicus M.16.27]
    MTQVIESYSSPFYKNIIDLPPSMVRKLWKSGKIIILDIRTPQEYEDHHIPGAILAPLNYLEHLTELFEDREVAVVCEHGN
    RASYATYGMPHLYKKKAYYMIGGMALWMAMGYEVESGMDENGVLWQKILEKKFNY