Sulfolobus islandicus M 14 25 uid58849

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|227826432|ref|YP_002828211.1| protein of unknown function DUF255 [Sulfolobus islandicus M.14.25]
    MNERLRNSQSGYLRKAVNHPINWYTWSNEIFEIAKSEDKPILIDVGAAWCHWCNVMDEDTYSNPEIVKIVNENFIPVKVD
    RDEMPDLDRLLQNAAMTITGESGWPLTIFMTPEGKVFFGGTYFPPEDKYGRIGFKKLLLEILRIWREDRNQIFSSSIDPN
    MLIARNTGGVLSSSVLDDAFSYITSYFDIEYGGLGFGAKFPHPFVDLLFLNYSATRGDDLGKKLGLFTLRKMYYGGIFDQ
    VGGGFHRYTVDREWKLPHFEKLLIDNAELIYDYFTYYTATNDIEILDALRNSVDFVLRELYMDGKGFANSLDADSEGMEG
    KYYTWTEDELKGALGNDYGIAIRVFDLKNTVEVEGRKVLLRTTELRELSKVTGLQANEIIEKVSEIRAKLLTYREQNRKM
    PYRDDSTYTYPNAKLTESILFSSLILNKGIEEAKLVLSKLGKSVSRRLDGGKAGLPEDYAAALLASISAYEVLSEEKYYD
    LAIELGRNIGGIRPNNFTDMPNESANSMYIRALFKLSLLSDEFKVDEGKIKPLIPSLTAENSQFIAGIVNTISSYINGMA
    HIVVVDEKDGLAERLHRTALLTYYPFKLIERVDDSRTDYVSSVIRAMIKYNAGKSRAYVCIGNTCSMPVSEEEKIKQLLK
    TKL

    >gi|227826461|ref|YP_002828240.1| thioredoxin [Sulfolobus islandicus M.14.25]
    MNDELNDPELQKILSKKANQILNSLKEKVEEPVKHLNSKNFEEFITKNKIAVVDFWAEWCAPCFILAPIIEELANDYPQV
    AFGKLNTEENQDIVMRYGIMSLPTVMLFKNGEPVDQILGAVPREEIEVRIKALLE

    >gi|227826479|ref|YP_002828258.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sulfolobus islandicus M.14.25]
    MNVGEEAPDFEAESTLGKIKLSDFRGKKVILYFYPKSFTSGCTRELQRFTELYDEFKKLNAEVIGVSVDKIDTQKKFAEK
    YGAKFPIVADAQKTISKLYSVLNERGTSAQRVTFIIDENGKIVDILKNLKKAEEHADKSLEIIKKQNST

    >gi|227826505|ref|YP_002828284.1| CoA-disulfide reductase [Sulfolobus islandicus M.14.25]
    MERLIIIGGGAAGMTAASWARRLKPNIDITVFESTKMVSHAPCGIPYFTEGLFDDENLFMTYTPEYFAEKRKINVKINSK
    VEEVDLRSRTITVRENQENKKYEFDYLLLSTGAKPKKLNAEGDRIFYVHHPADASYIRQKLWSFDRIAIIGGGILGIEMA
    EALRARGKKLVLIHRGKYLLNKMLDEDMGKIITDKVGSEIELKLNESLISVTERGRLIVTDKGKYEVDATVVGIGVEPNV
    DLVKDQLKIGETGAIWADNHMRTSFENVYAAGDSTESINIITKKPDWVPFAPVANKMGFVAGNNIGGKDVTFPGVIGTMI
    TKFEEYVIAKTGITENEAKRHNIKTVSATVHHKTRARYYPGSKDIIVKLIAEANTMRIIGAQIIGEEEVLGRLNMMAAVI
    QKGFTAEELFFVETGYVPPVNRVWDAITLAARKLYTGISGE

    >gi|227826618|ref|YP_002828397.1| thioredoxin reductase [Sulfolobus islandicus M.14.25]
    MSLLPRTASVKPGEKFDVIIVGLGPAAYGAALYTARYMLKTLVIGETPGGQLTEAGIVDDYLGLIEIQASDMIKVFNKHI
    EKYEVPVLLDIVEKIENRGDGFVVKTKRKGEFKADSVILGIGVKRRKLGVPGEQEFVGKGISY
    CSVCDAPLFKNRVVAVV
    GGGDSALEGAEILSSYSTKVYLIHRRDSFKAQPIYVETVKKKPNVEFVLNSVVKEIKGDKVVRQVVVENLKTGEIKELNV
    NGVFVEIGFDPPTDFAKSNGIETDTNGYIKVDEWMRTSVPGIFAAGDCTSMWLGFRQVITSVAQGAVAATSAYRYVTEKK
    GKK

    >gi|227826679|ref|YP_002828458.1| methylated-DNA--protein-cysteine methyltransferase [Sulfolobus islandicus M.14.25]
    MLVYGLYKSPLGYITVAKDDKGFIMLDFCDCVEGNSRDDSSFTEFFHKLDLYFEGKPINLREPINLKTYPFRLSVFKEVM
    KIPWGKVMTYKQIADSLGTSPRAVGMALSKNPILLIIP
    CHRVIAENGIGGYSRGVKLKRALLELEGVKIPE

    >gi|227826734|ref|YP_002828513.1| conserved hypothetical selenoprotein [Sulfolobus islandicus M.14.25]
    MQDPVCKMEVENTTPYRINYRGITYYFCSKGCLDEFKKNLTKYVSPADLNKKIDVKIVYCRPCKYMDRALNLARDILSYF
    EEVNVELVQGDRGILDIYVNDELVFSRYIEKRFPESEEILKSIGQKLQLARQS

    >gi|227826735|ref|YP_002828514.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Sulfolobus islandicus M.14.25]
    MREKSCDYLIIGSGIAGYNALKELLELKPNSKIIMVSSDKYYPYDRPPLSKYYLRGEMAREKLFFESDDFYKRSNLDVVL
    NRNVERIDTISKEAILNDGSVISFDRALIASGGRPRRLSVPGGENALYLRTLDD
    CDGIREVASRSRNALIIGAGFIGVEV
    ASSLTTLGVRTTVVEVMPYIWNTFVDEKVSRVIRQYLEGKGINFILNESVREIQGKAAITSGGKRLEADMFLIAVGIVPN
    VEVAQKSGIQVDNGVIVNEYLETSAKDIYAAGDVASIFDPREGRRKRIEHWNNAEYTGKLAARNMAGNREAYNFISSIWS
    DIFDIHIESAGETRNYDEYVIRGRFNSDSPNFNVIYLKGGIVKGYVAINRDYGELEVLNKLIKEGKDVSNKKNSLADEGF
    DLKELLK

    >gi|227826752|ref|YP_002828531.1| putative peroxiredoxin [Sulfolobus islandicus M.14.25]
    MSEGRIPLIGEKFPEMEVITTHGKIKLPDDYKGRWFVLFSHPGDFTPVCTTEFYSFSKKYEEFKKLNTELIGLSVDSNIS
    HIEWVMWIEKNLKVEVPFPIIADPMGNVAKRLGMIHAESSTATVRAVFIIDDKGTVRLILYYPMEIGRNIDEILRAIRAL
    QLVDKAGVVTPANWPNNELIGDKVINPAPRTIKDAKMRLGQPFDWWFTYKEVKTT

    >gi|227827012|ref|YP_002828791.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sulfolobus islandicus M.14.25]
    MVKVGDKAPLFEGIADNGERISLSHFIGKHNIVLYFYPKDDTPGCTREACAFRDNWDLLKDYDVVVIGVSSDDINSHKKF
    KEKYKLPFILVSDPDKKIRELYGAKGFILPARITFVIDKKGIIRHIYNSQTNPANHVNEALKTLKQIKAEEIS

    >gi|227827159|ref|YP_002828938.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Sulfolobus islandicus M.14.25]
    MKVVIIGAGPAGVYSALTLSKHAKVTLIEKEEKLGGTCVLYGCIPTKSILSQLIISRQASNMSLNTFREYALASINTISK
    SLEQLLNSHGIEVIHANGFLRSSMVHASDTSLTADKVLVSTGTRRERLGKVKFTEDLAYTNEDYNKVVIVGGDAGGIELA
    WMMKKLGKEVHLIDKNDLLLQNIDNTLSEVVTNFLSRIGIKLYLGKKVSKIDETSVTLEDNQTISGDAVFVTFGRKPNIE
    GFEEIPHEKYIYVDEYLRTQIPNIYAAGDIIGTFTAHEAIYGGIIAAKNMLGEKREFLVEGIPKVIYIYPQIAYVGTTIG
    NCVTFNTLNLTRTVVEREGEGFLKICERDNRVIGGVAFMPYAEDVISLISVLIRYQINLKDTIDLVMPHPSYLEAITEAL
    NMLQSKE

    >gi|227827385|ref|YP_002829164.1| DsrE family protein [Sulfolobus islandicus M.14.25]
    MAQAQTQGQEEEQKKKILIVVTHGPEDLDRTYAPLFMASIAASMEYETSVFFMIKGPKLLDKKWQEEERKKGGNPFIHFF
    DMAKDNGVKMYV
    CVQSLKDMCHMKEDDVVEGIELVGGSTLIDLTMDADRTLFF

    >gi|227827386|ref|YP_002829165.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Sulfolobus islandicus M.14.25]
    MKYDIVVIGGGTAGYVAGSILARKGKKVIVIEKEKFGGVCVNFGCVPSIFLFDVTFLLNRFKEIVYYLGLDGEIEYKDLL
    FSKRNEIVNYLSNAGRRLIEDSGGETELGEAEIISPSEVKVNGRIVEFDKLIIATGSKPMIPNIDGIEDAISEDDAVNLN
    FIPSSMVVIGGGYAGVEIAQIYSRLGSQVTLLSRSEILPTFPEDVRSVVKDSLEFDGVNVVENTRIVKLRDGKVITEKGE
    IEGNVIVYATGRRPQLPKGIEKLGLEIDECGINVDKYKQIKNNAYAIGDVINKERKTAHSAMFDALVASLHILKETTFIP
    PDNFKIPVVLYTDPQVGVIGDHKEAKKFSVFPFAAITRAIINGIKDGYVKIGINERNEIVFGEVIGDKAEELINILTLVV
    NNRMRIESLALMPFVHPSLSEAIVNAAKGFFDLDVDRYKSKDGKT

    >gi|227827388|ref|YP_002829167.1| glutaredoxin related protein [Sulfolobus islandicus M.14.25]
    MSYDYVIKEYLNAIKKGDITIQQCNGDDLFHEFKNYVKVETLDNCKKPLVKVKKGHRVYYTYYGIPIANELWPFLNSLVR
    ISNNVVNLDEKEMELARQVRGNVKLFVTPD
    CTKCPITAEFLYQVSQINENVKLEIYDTTEYEEERDKYRILSVPKIIFNE
    KVEIPGGFPSTMILKMMLKALQSELR

    >gi|227827430|ref|YP_002829209.1| DSBA oxidoreductase [Sulfolobus islandicus M.14.25]
    MVVKITFFHDVLCPFCFVTSRRLRSVARKFNDEIVVKHKAFMIISSLDDLKAAAPTEEEARELFKQEFSIIKRYFPDYEP
    EKVIGKGKITWVWSLPPLMACKAAEYQRGDNGYWDYFDKAQERFFLEGENVNDDNVLIQIAEELGLDIEKFKEDFKSKKA
    RMSVYEDEAEAHAMGIRGVPALLVNDYWLIRGVQDEAYLESVVEDLLSNGGEPKKVKLKAYWEAT

    >gi|227827443|ref|YP_002829222.1| OsmC family protein [Sulfolobus islandicus M.14.25]
    MTTITFTAEGKLERDKVIVDLNGTEIRVGLLGSDNPTPEEFCLASAISCLILTMYYIAREKGVAINSIEGYIEGKMDTKG
    FQGFKEVPPGLLEVNYELIVDSKDTRISEILKEAEER
    CPMRDTLTRSVKVNINWKIKS

    >gi|227827483|ref|YP_002829263.1| Rhodanese domain protein [Sulfolobus islandicus M.14.25]
    MLVSVEWLNNNLKDVKVVEIGYNPQINYYEGHIPGAVLINWRDFLDDNSRDFASPGKLSKVLGNAGINNDDLIVLYSEMN
    NRYAFYVYWILKAYGHSNLAILNGGIYKWLKEGYPIESDGVVVNKKSEYKARKPDWSSRILVWELLSKLKEFVLIDSRSK
    EEYDGLTTAPPEHKCEQTQMSGHIPGAKNIPWTILLNEDETMKSRDELERIFSWLSKEDKIVVY
    CRTGARASVAWYALKE
    VLGFKLVRLYDGSWVEYGNMVGVPVEKSVSDRF

    >gi|227827486|ref|YP_002829266.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Sulfolobus islandicus M.14.25]
    MILILGGGFAGVSAYNQNKENSLVVDRKDYFLLTPWIIDFICGMKKLEDIIVKYKKVILGNVQKIDFKNKKVILDNSKEL
    TYDKLIVSLGHHQNLPRLKGAKEYAHKIETLEDAIELKRRLNEVKDITIIGGGATGVELAGNIKGKKISLVQRRNRLLPT
    MSTASSKKAEDLLRELGVNLMLGVEAIEIKKDSVVTSYGEIKTELTIFAGGLKGPQIVGNLHANKNHRLLVDKNLKSIEY
    NDVYGAGDCVTFEDKEIPMTADIAVAAGRVVMKNILGNEIEFKPKRLATTIRIRNEFFGDFGENYVEGKFAKILKDISYL
    ESLLLPRRLRE

    >gi|227827999|ref|YP_002829779.1| thioredoxin [Sulfolobus islandicus M.14.25]
    MSEIDSLIREVAERLQKKAEEYGKKKEDATLVLTEENFDEVIRNNKLVLVDCWAEWCAPCHLYEPIYKKVAEKYKGKAVF
    GRLNVDENQKIADKYSVLNIPTTLIFVNGQLVDSLVGAVDEDTLESTINKYLE

    >gi|227828051|ref|YP_002829831.1| hypothetical protein M1425_1788 [Sulfolobus islandicus M.14.25]
    MEVQIFTHKNCVECNMLLEYLENKGLLGKVKIIDTELYPFLAFERGVISTPSIFIDGKLVYAGIVDFEEFERILSGEKVT
    RQIDKDKLVEKLMLGIVDSFAATAWLYINRDFDSFLAQKDFVMAVTGLSLLDEKEREEYYNYLRNIMIKEGEKYLEEWKP
    RMLRNISSNFIREIFWLYETKISKEVVMQKYPVEVFAHWLMVRGGAVGRVGLRIYPLSDSTLMRRVLEAYNFMLENYDDI
    FNKVQKEQTELKAKNREQVRYLQI

    >gi|227828065|ref|YP_002829845.1| UBA/THIF-type NAD/FAD binding protein [Sulfolobus islandicus M.14.25]
    MITFLLAFSATCLNLSNSSIDIGVPSLPPPFSIGTISIPTFSRQHLFLKIILHYNLVERYSRQLLVLGLGVQQRLNELKI
    LIAGCGALGSAIAELLARLGVGEITVVDADVVDVTNLHRVHLFDENDVGKPKAEICAKKLSLINSSIKINYIIDILDEQN
    VEKLISDKDYVFDALDSLYYKLLLNDATVKLRKILIYGGINGEYGSVKLIDSNQTSCLSCFINYSDQDEIGNS
    CDVIGTT
    PLIVELTATLQVNLMLNHLRGNPDYSLFYIDSRELKIERINIEKNFQCKTCVLNEYPFLNQKITKPNCGIFRVNMKVTEL
    DKPKVFKNIGNAILCYPNIGCFEKRGR

    >gi|227828204|ref|YP_002829984.1| glutaredoxin-like domain protein [Sulfolobus islandicus M.14.25]
    MEQEYAELFSDEVKNALQDALKDMRNPVDVYVFVDSEDSNCQYCSVTTKFLEFIASAAPKDGNGSLLKVHIVDRVNQNDR
    KIFEEFNVERVPTVAFYNGYIRWTGAPLGEEIRALVETIVRLSQGESGLSQETVEAIKSKLNGKVKIETVVTPS
    CPYCPY
    AALMAHMVAFEACRAGKCNVVSDVVEAYENQDIAEKYQVMSVPSIAINESVEFIGVPYEENFINAILEKQKIS

    >gi|227828526|ref|YP_002830306.1| protein of unknown function DUF395 YeeE/YedE [Sulfolobus islandicus M.14.25]
    MPSMVLQPVLQESWALIYGLFALSGFILGWAAQRGNYCFVNAMTSIFTAKSYERFGALLILFGLSALGTGLLVAFGVIPA
    FDQYYYNYFAGWYILVGSIIFGFGVALAGG
    CNLSMLYRAASGYVQNWIELFGMMIGTYVFAIGIWPFQLYTMANGILSTT
    NGGYVEYLPYIIFHSISNMSVYITTLVVSLPLIFIGIYLQQYTKRKWAISSSLRINLPAARAYYNQNISTSGEEKVSLTK
    EIKDLILLRKPYGTNLTTIILALDLLLVFIVGAGYTFNYLVITSSDGGRFFEYLLMLGNVKLFLNTPWFNDSLPIVDPST
    LMVIMLCIGAFSASYLSGDFKIRIPRNKSRLLIGFGGGMLVGIGVRMALG
    CNVGLMWTNFAQLGYDGIIFLFGMLLGVYL
    AIKVQERWL

    >gi|227828663|ref|YP_002830443.1| Rhodanese domain protein [Sulfolobus islandicus M.14.25]
    MSQVQEQQVIVDNKWVLDHLKDQKVRIVEVDYDPNTAYNVWHIPGAVLVRWREDLRHPVLRDFIEPSQFEKLMESKGISN
    NTTIVLYGDYNNWFAVYAFWLFKSYGHDDVRILNGGRTKWAKENLPTEQGAKEPQYPKGSYKVKKVDWGSHRAFFWEVLQ
    KITKGEVGRTTILVDVRSPKEYTGEIRAPPEYADEQTQVGGHIPGAVSFPWAQAVNPDTGEFKSIEELRRLVESAGITPE
    KEIITY
    CRIGERASHTWFVLKYLLGYPAVRVYDGSWAEWGNIVGAPVKKGTEP

    >gi|227828784|ref|YP_002830564.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Sulfolobus islandicus M.14.25]
    MPLKTFDTIIVGAGIAGLSAALYSSRQKLSTLVLSKDLGGQLTLTDLIENYPGIESTGGLSLAQKIEKQAKKFGAEFIYG
    EEVKEIAQESDVFIIKGIKGEYAGRAIILAFGKTPREINVPGEQEFKGKGVSY
    CAICDAAFFKGKPAAVVGEGEPGIEAI
    ELLSNYANPAYYITSSSYLAGEEEIVKNVLNKPNVKIFTSSKVLEIRGNSKVEEIMIKKGDEIISLRVDGVIIEMGYVLK
    TEFLKGFVELNEKGEIVVDELGRTSREGVFAAGDVTQTPYKQAVVAAAEGVKAALSAYNYIRSKKGLPPVNVDWKAEKKK
    ISFRL

    >gi|227828852|ref|YP_002830632.1| mercuric reductase [Sulfolobus islandicus M.14.25]
    MEDLVIIGYGAAGFAALIRANQLGIKPVVVGYGEIGGTCVNVGCVPSKRMLRIGELYNNSSKIVGKKLFPEFFQAFQDKA
    EIVNSLRKEKYEDVINSYDVKLIIGKAHFISPNAIKVNGETIEAKKFIIATGSSPNVPNINGLTEVGFWTNVEALSPDKT
    ISSLAIIGGRALALEFAQMYKRLGVDTIILQRSERILPDWEPEISLSVKNYLEKNDNIPIFTNVRVKEVRKGNGGKIVVT
    DKGEVEADEILLATGRKPNVEMNLDAAGIELNDKGGIKVNEELRTSNPNVYAAGDVIGGPMLEALAGRQGSIAAENAIMN
    VKRKIDMSSVPQVVFIEPNVAKVGLTALEAMKEGYDIDHRVVKMNNIAKARILREDYGLIKMVIDKKFRNILGVQMFGKY
    AAEVINEAALAVKFRATIDDLIDTIHVFPTMAESLRIVALAFTSDVSKMSC
    CV

    >gi|227828890|ref|YP_002830670.1| heavy metal translocating P-type ATPase [Sulfolobus islandicus M.14.25]
    MVTEKKEELRITDKEEQLKIIGMHCATCVMSVSKSLKSVSGVKDAEVNLATGSAKVILSVNVRLKELVKAVRKAGYDVAT
    EKFTIKLNVNPEEMPKIERKFENVKGVVDVKSNPGLGIVSVEYNPESTTPEEILKEAGVKGEIINEQRSERSILYKDFYD
    LLKRLVIGITFTPLTYLFPFFLGILLSIPIQFYSGLRFHKGAYRALKNRTTNMDVLVSLASNILWFSGIFLHSTFYADAS
    LLITFILVGKTLEAYIKAKMSSEIRIEPYKATLKDGRVVNSNELKVGDIVIVRTGERIPADGIIESGEGEVNEAIITGEQ
    KPVLKRKGDNVLAGGILVNGYLEIYVTRNWDRSYIIQVIESVRGAYNARVSIQNLVDKVSSVFVPIVITLSALTFLVWKF
    VLGYNLYSSLFFSVAVLAAACPCALGLASPMAMLVSVRRALKRGIIIRDGSILEEIRNVNVAVLDKTGTVTEGEYVIVSK
    KEFINVALDLAAIAESRSIHPIAKAFHKMNMKDGKVEQFEEFPGRGIYARINGNDVIVGSKDFVKSNCDWNVEDEGDILV
    CINGRAGGIVNIRDKLRDDAKRVINYMKERGIMVIIATGDSSNYADEIGKELGIEVRKGLTPDNKAELVKELRENGNKVM
    FIGDGINDAIAMREADVGIAISSGTDLAKSAGKVVINSLDDVIGLFEQAKLGVRKIKENLAWAFGYNTVIIPIAAGLFYP
    TIYLPPEYAALAMGFSSVIVSLWSLVPI

    >gi|227828904|ref|YP_002830684.1| Rhodanese domain protein [Sulfolobus islandicus M.14.25]
    MMLITERRSPFYPNIQNVPPSVIRKLVKNKEIQLIDIRQPWEYEDHHIPGSILLPLDYFEDLFQLMLNKSNIGIICEHAN
    RSTWLVYTKPSLFKEVKVYNMLGGIELWMMMGYEVEKGMDNNGTLWYKLLTKNLR

    >gi|227828926|ref|YP_002830706.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sulfolobus islandicus M.14.25]
    MVEIGQKAPELELVDTDLKKVKIPSDFKGKVVVLAFYPAAFTSVCTKEMCTFRDSMAKFNEVNAVVIGVSVDPPFSNKAF
    KEQNKLNFTIVSDFNREAVKAYGVAGELPILKGYVLAKRSVFVIDKNGIIRYKWVSEDPTKEPNYDEIKDVISKLS

    >gi|227828970|ref|YP_002830750.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Sulfolobus islandicus M.14.25]
    MPKSIIFLMKVAVIGSGPAGIDASLELAKNNKVILVEKEERLGGTCVLYGCIPSKAMLHPIHLASELEKLGKSIVFDLGE
    LRKLGQEASFRLSKGVEYMLEDNGVEVIYGIASLRSGQLNVNNETLQADYIVLATGTYREVVKGIIYSEDLPYLDKDFQS
    VVIVGGDVGGVEFGWMLRKLGKEVVLIDKQSSLLPYLDKEVSNAITNYFSKIGVKLYLNRSVKEMKEREVVLENGERLTA
    DVVYMTFGRKPSIQGFEEVNHNPFVTVDEYLRTSISNVFAAGDIIGTHTAHEAMYAGKVAAINVMGGKKVFNKQGIPKVV
    YTHPTIAYVGSMEGKCAKINLAEIGRAITEKETDGFLKICVKDDKIVGAQAFMKDAEEVISLISFLIRYNIKVSEIKDYV
    APHPSYIEAITELISRL

    >gi|227828988|ref|YP_002830768.1| Rhodanese domain protein [Sulfolobus islandicus M.14.25]
    MTQVIESYSSPFYKNIIDLPPSMVRKLWKSGKIIILDIRTPQEYEDHHIPGAILAPLNYLEHLTELFEDREVAVVCEHGN
    RASYATYGMPHLYKKKAYYMIGGMALWMAMGYEVESGMDENGVLWQKILEKKFNY