Sulfolobus islandicus L S 2 15 uid58871

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|227829041|ref|YP_002830820.1| protein of unknown function DUF255 [Sulfolobus islandicus L.S.2.15]
    MNERLRNSQSGYLRKAVNHPINWYTWSNEIFEIAKREDKPILIDVGAAWCHWCNVMDEDTYSNPEIVKIVNENFIPVKVD
    RDEMPDLDRLLQNAAMAITSESGWPLTIFMTPEGKVFFGGTYFPPEDKYGRIGFKKLLLEILRIWREDRNQIFSSSIDPN
    MLIARNTGGVLSSSVLDDAFSYITSYFDIEYGGLGFGAKFPHPFVDLLFLNYSATRGDDLGKKLGLFTLRKMYYGGIFDQ
    VGGGFHRYTVDREWKLPHFEKLLIDNAELIYDYFTYYTATNDIEILDALRNSVDFVLRELYMDGKGFANSLDADSEGMEG
    KYYTWTEDELKGALGNDYGIAIRVFDLKNTVEVEGRKVLLRTTELRELSKVTGLQANEIIEKVSEIRAKLLTYREQNRKM
    PYRDDSTYTYPNAKLTESILFSSLILNKGIEEAKLVLSKLGKSVSRRLDGGKAGLPEDYAAALLASISAYEVLSEEKYYD
    LAIELGRNIGGIRPNNFTDMPNESANSMYIRALFKLSLLSDEFKVDEGKIKPLIPSLTAENSQFIAGIVNTISSYINGMA
    HIVVVDEKDGLAERLHRTALLTYYPFKLIERVDDSRTDYVSSVIRAMIKYNAGKSRAYVCIGNTCSMPVSEEEKIKQLLK
    TKL

    >gi|227829070|ref|YP_002830849.1| thioredoxin [Sulfolobus islandicus L.S.2.15]
    MNDELNDPELQKILSKKANQILNSLKEKVEEPVKHLNSKNFEEFITKNKIAVVDFWAEWCAPCFILAPIIEELANDYPQV
    AFGKLNTEENQDIVMRYGIMSLPTVMFFKNGEPVDQILGAVPREEIEVRIKALLE

    >gi|227829088|ref|YP_002830867.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sulfolobus islandicus L.S.2.15]
    MNVGEEAPDFEAESTLGKIKLSDFRGKKVILYFYPKSFTSGCTRELQRFTELYDEFKKLNAEVIGVSVDKIDTQKKFAEK
    YGAKFPIVADAQKTISKLYSVLNERGTSAQRVTFIIDENGKIVDILKNLKKAEEHADKSLEIIKEQNST

    >gi|227829114|ref|YP_002830893.1| CoA-disulfide reductase [Sulfolobus islandicus L.S.2.15]
    MERLIIIGGGAAGMTASSWARRLKPNIDITVFESTKMVSHAPCGIPYFTEGLFDDENLFMTYTPEYFVEKRKINVKINSK
    VEEVDLRSRTITVRENQENKKYEFDYLLLSTGAKPKKLNAEGDRIFYVHHPADASYIRQKLWSFDRIAIIGGGILGIEMA
    EALRARGKKLVLIHRGKYLLNKMLDEDMGKIITDKVGSEIELKLNESLISVTERGRLIVTDKGKYEVDATVVGIGVEPNV
    DLVKDQLKIGETGAIWADNHMRTSFENVYAAGDSTESINIITKKPDWVPFAPVANKMGFVAGNNIGGKDVTFPGVIGTMI
    TKFEEYVIAKTGITENEAKRHNIKTVSATVHHKTRARYYPGSKDIIVKLIAEANTMRIIGAQIIGEEEVLGRLNMMAAVI
    QKGFTAEELFFVETGYVPPVNRVWDAITLAARKLYTGISGE

    >gi|227829259|ref|YP_002831038.1| thioredoxin reductase [Sulfolobus islandicus L.S.2.15]
    MSLLPRTASVKPGERFDVIIVGLGPAAYGAALYTARYMLKTLVIGETPGGQLTEASIVDDYLGLIEIQASDMIKVFNKHI
    EKYEVPVLLDIVEKIENSGDGFVVKTKRKGEFKADSVILGIGVKRRKLGVLGEQEFVGKGISY
    CSVCDAPLFKNRVVAVV
    GGGDSALEGAEILSSYSTKVYLIHRRDSFKAQPIYVETVKKKPNVEFVLNSVVKEIKGDKVVRQLVVENLKTGEIKELNV
    NGVFVEIGFDPPTDFAKSNGIETDTNGYIKVDEWMRTSVPGIFAAGDCTSMWLGFRQVITSVAQGAVAATSAYRYVTEKK
    GKK

    >gi|227829327|ref|YP_002831106.1| methylated-DNA/protein-cysteine methyltransferase [Sulfolobus islandicus L.S.2.15]
    MLVYGLYKSPLGYITVAKDDKGFIMLDFCDCVEGNSRDDSSFTEFFHKLDLYFEGKPINLREPINLKTYPFRLSVFKEVM
    KIPWGKVMTYKQIADSLGTSPRAVGMALSKNPILLIIP
    CHRVIAENGIGGYSRGVKLKRALLELEGVKIPE

    >gi|227829368|ref|YP_002831147.1| hypothetical protein LS215_0358 [Sulfolobus islandicus L.S.2.15]
    MQDPVCKMEVENTTPYRINYRGITYYFCSKGCLDEFKKNLTKYVSPADLNKKIDVKIVYCRPCKYMDRALNLARDILSYF
    EEVNVELVQGDRGILDIYVNDELVFSRYIEKRFPESEEILKSIGQKLQLARQS

    >gi|227829369|ref|YP_002831148.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Sulfolobus islandicus L.S.2.15]
    MREKSCDYLIIGSGIAGYNALKELLELKPNSKIIMVSSDKYYPYDTPPLSKYYLRGEMAREKLFFESEDFYKRGNLDVVL
    NRSVERIDTDSKEAVLNDGSVISFDRALIASGGRPRRLSVPGGENALYLRTLDD
    CDGIREVASRSRNALIIGAGFIGVEV
    ASSLTTLGVRTTVVEVMPYIWNTFVDEKVSMVIRQYLEGKGISFILNESVREIQGKAAITSGGKRLEADMFLIAVGIVPN
    VEVAQKSGIQVDNGIIVNEYLETSAKDIYSAGDIANIFDPREGRRKRIEHWNNAEYTGKLAARNMAGNREAYNFISSIWS
    DIFDIHIESAGETRNYDEYVIRGRFNSDNPNFNVIYLKGGIVKGYVAINRDYGELEVLNKLIKEGKDVSNKKNSLADEGF
    DLKELLK

    >gi|227829385|ref|YP_002831164.1| putative peroxiredoxin [Sulfolobus islandicus L.S.2.15]
    MSEGRIPLIGEKFPEMEVITTHGKIKLPDDYKGRWFVLFSHPGDFTPVCTTEFYSFSKKYEEFKKLNTELIGLSVDSNIS
    HIEWVMWIEKNLKVEVPFPIIADPMGNVAKRLGMIHAESSTATVRAVFIIDDKGTVRLILYYPMEIGRNIDEILRAIRAL
    QLVDKAGVVTPANWPNNELIGDKVINPAPRTIKDAKMRLGQPFDWWFTYKEVKTT

    >gi|227829519|ref|YP_002831298.1| Radical SAM domain protein [Sulfolobus islandicus L.S.2.15]
    MIPISVLVTNAGTVSFHIKGEYNKDRPSKFSDVFRPVVTWNLTRKCNLKCLHCYINASPEGEDGSTTEEALRLIDEMAEM
    RIPLIIMSGGEPLMRRDFFELASYARIKGIKLALSTNGTLITESVAKKLKELDFSYVGISLDSYDPEFHDKFRGLNGAFN
    MTVKGIKNAINVGLNVGLRFTITARNIHQIDEYVKLALELGVKRITFYHLSASGRGKELREWMYTPEEYVGFINKMIDYA
    IKLSGKIEIETTLGQFDGVYIAKKLARDEEELEKYMKFVENSGGCGRKMISIYPNGDVYPCQFIDFYKLGNVREKPLKEI
    IKNIPDLFINTDKYLRGEYCDKCKYKSA
    CKGGDRARAYYWNGDVYGDDPLCPLKTLHI

    >gi|227829708|ref|YP_002831487.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Sulfolobus islandicus L.S.2.15]
    MKVVIIGAGPAGVYSALTLSKNAKVTLIEKEEKLGGTCVLYGCIPTKSILSQLIISRQASNMSLNTFREYALASINTISK
    SLEQLLNSHGIEVIHANGFLRSSMVHASNTSLTADKVLVSTGTRRERLGKVKFTEDLAYTNEDYNKVVIVGGDAGGIELA
    WMMKKLDKEVHLIDKNDLLLQNIDNTLSEVVTNFLSHIGIKLYLGKKVSKIDETSVTLEDNQTISGDAVFVTFGRKPNIE
    GFEEIPHEKYIYVDEYLRTQIPNIYAAGDIIGTFTAHEAIYGGIIAAKNMLGEKREFLVEGIPKVIYIYPQIAYVGTTIG
    NCVTFNTLNLTRTVVEREGEGFLKICERDNRVIGGVAFMPYAEDVISLISVLIRYQINLKDTIDLVMPHPSYLEAITEAL
    NMLQSKE

    >gi|227829788|ref|YP_002831567.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sulfolobus islandicus L.S.2.15]
    MNNKNKRNKGLKRSRIAIYSVIFIIILIIGLYFILSKSNNVGVAVGDIAPNATFTLINGTKINLYNFHGKYVLLYFIVTW
    CETCAEGLHILSQIIPTLASKNITVSVVESYNDLGYQGIPLNEFIKSYANSNITFYYGYATLAMTKEYNPNGYLDIYYLL
    SPSGKIIYIAVVLL

    >gi|227829894|ref|YP_002831673.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sulfolobus islandicus L.S.2.15]
    MVKVGDKAPLFEGIADNGERISLSHFIGKHNIVLYFYPKDDTPGCTREACAFRDNWDLLKDYDVVVIGVSSDDINSHKKF
    KEKYKLPFILVSDPDKKIRELYGAKGFILPARITFVIDKKGIIRHIYNSQTNPANHVNEALKTLKQIKAEEIS

    >gi|227830078|ref|YP_002831857.1| DsrE family protein [Sulfolobus islandicus L.S.2.15]
    MAQAQTQGQEEEQKKKILIVVTHGPEDLDRTYAPLFMASIAASMEYETSVFFMIKGPKLLDKKWQEEERKKGGNPFIHFF
    DMAKDNGVKMYV
    CVQSLKDMCHMKEDDVVEGIELVGGSTLIDLTMEADRTLFF

    >gi|227830079|ref|YP_002831858.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Sulfolobus islandicus L.S.2.15]
    MKYDIVVIGGGTAGYVAGSILARKGKKVIVIEKEKFGGVCVNFGCVPSIFLFDVTFLLNRFKEIVYYLGLDGEIEYKDLL
    FSKRNEIVNYLSNAGRRLIEDSGGETELGEAEIISPSEVKVNGRIVEFDKLIIATGSKPMIPNIDGIEDAISEDDAVNLN
    SIPSSMVVIGGGYAGVEIAQIYSRLGSQVTLLSRSEILPTFPEDVRSVVKDSLEFDGVNVVENTRIVKLRDGKVITEKGE
    IEGNVAVYATGRRPQLPKGIEKLGLEIDECGINVDKYKQIKNNAYAIGDVINKERKTAHSAMFDALVASLHILKETAFIP
    PDNFKIPVVLYTDPQVGVIGDHKEAKKFSVFPFAAITRAIINGIKDGYVKIGINERNEIVFGEVIGDKAEELINILTLVV
    NNRMRIESLALMPFVHPSLSEAIVNAAKGFFDLDVDRYKSKDGKT

    >gi|227830081|ref|YP_002831860.1| glutaredoxin-like protein [Sulfolobus islandicus L.S.2.15]
    MSYDYVIKEYLNAIKKGDITIQHCNGDDLFHEFKNYVKVETLDNCKKPLVKVKKGDRVYYTYYGIPIANELWPFLNSLVR
    ISNNIVNLDEKEMELARQVRGNVKLFVTPD
    CTKCPITAEFLYQVSQINENVKLEIYDTTEYEEERDKYRILSVPKIIFNE
    KVEIPGGFPSTMILKMMLKALQSELR

    >gi|227830123|ref|YP_002831902.1| DSBA oxidoreductase [Sulfolobus islandicus L.S.2.15]
    MVVKITFFHDVLCPFCFVTSRRLRSVARKFNDEIVVKHKAFMIISSLDDLKAAAPTEEEARELFKQEFSIIKRYFPDYDP
    EKVIGKGKITWVWSLPPLMACKAAEYQRGDNGYWDYFDKAQERFFLEGENVNDDNVLIQIAEELGLDIEKFKEDFKSKKA
    RMSVYEDEAEAHAMGIRGVPALLVNDYWLIRGVQDETYLESVIEDLLSNGGEPKKVKLKAYWEAT

    >gi|227830136|ref|YP_002831915.1| OsmC family protein [Sulfolobus islandicus L.S.2.15]
    MTTITFTAEGKLERDKVIVDLNGTEIRVGLLGSDNPTPEEFCLASAISCLILTVYYIAREKGVAINSIEGYIEGKMDTKG
    FQGFKEVPPGLLEVNYELIVDSKDTRISEILKEAEERCPMRDTLTRSVKVNINWKIKRS

    >gi|227830175|ref|YP_002831955.1| Rhodanese domain protein [Sulfolobus islandicus L.S.2.15]
    MLVSVEWLNNNLKDVKVVEIGYNPQINYYEGHIPGAVLINWRDFLDDNSRDFASPGKLSKVLGNAGINNDDLIVLYSEMN
    NRYAFYVYWILKAYGHSNLAILNGGIYKWLKEGYPIESDGMVVNKKSEYKARKPDWSSRILVWELLSKLKEFVLIDSRSK
    EEYDGLTTAPPEHKCEQTQMSGHIPGAKNIPWTILLNEDETMKSRDELERIFSWLSKEDKIVVY
    CRTGARASVAWYALKE
    VLGFKLVRLYDGSWVEYGNMVGVPVEKSVSDRF

    >gi|227830178|ref|YP_002831958.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Sulfolobus islandicus L.S.2.15]
    MILILGGGFAGVSAYNQNKENSLVVDRKDYFLLTPWIIDFICGMKKLEDIIVKYKKVILGNVQKIDFKNKKVILDNSKEL
    TYDKLIVSLGHHQNLPRLKGAKEYAHKIETLEDAIELKRRLNEVKDITIIGGGATGVELAGNIKGKKITLVQRRNRLLPT
    MSTASSKKAEDLLRELGVNLMLGVEAIEIKKDSVVTSYGEIKTELTIFAGGLKGPQIVGNLHANKNHRLLVDKNLKSIEY
    NDVYGAGDCVTFEDKEIPMTADIAVAAGRVVMKNILGNEIEFKPKRLATTIRIRNEFFGDFGENYVEGKFAKILKDISYL
    ESLLLPRRLRE

    >gi|227830736|ref|YP_002832516.1| thioredoxin [Sulfolobus islandicus L.S.2.15]
    MSEIESLIREVAERLQQKAEEYGKKKEDATLVLTEENFDEVIRNNKLVLVDCWAEWCAPCHLYEPIYKKVAEKYKGKAVF
    GRLNVDENQKIADKYSVLNIPTTLIFVNGQLVDSLVGAVDEDTLESTINKYLE

    >gi|227830788|ref|YP_002832568.1| hypothetical protein LS215_1928 [Sulfolobus islandicus L.S.2.15]
    MEVQIFTHKNCVECNMLLEYLENKGLLGKVKIIDTELYPFLAFERGVISTPSIFIDGKLVYAGIVDFEEFERILSGEKVT
    RQIDKDKLVEKLMLGIVDSFAATAWLYINRDFDSFLAQKDFVMAVTGLSLLDEKEREEYYNYLRNIMIKEGEKYLEEWKP
    RMLRNISSNFIREIFWLYETKISKEVVMQKYSVEVFAHWLMVRGGAVGRVGLRIYPLSDSTLMRRVLEAYNFMLGNYDDI
    FNKVQKEQTELKAKNREQVRYLQI

    >gi|227830802|ref|YP_002832582.1| UBA/THIF-type NAD/FAD binding protein [Sulfolobus islandicus L.S.2.15]
    MITFLLAFSATCLNLSNSSIDIGVPSLPPPFSIGTISIPTFSRQHLFLKIILHYNLVERYSRQLLVLGLGVQQRLNELKI
    LIAGCGALGSAIAELLARLGVGEITVVDADVVDVTNLHRVHLFDENDVGKPKAEICAKKLSLINSSIKINYIIDILDEQN
    VEKLISDKDYVFDALDSLYYKLLLNDATVKLRKILIYGGINGEYGSVKLIDSNQTSCLSCFINYSDQDEIGNS
    CDVIGTT
    PLIVELTATLQVNLMLNHLRGNPDYSLFYIDSRELKIERINIEKNFQCKTCVLNEYPFLNQKITKPNCGIFRVNMKVTEL
    DKPKVFKNIGNAILCYPNIGCFEKRGR

    >gi|227830963|ref|YP_002832743.1| glutaredoxin-like domain protein [Sulfolobus islandicus L.S.2.15]
    MEQEYAELFSDEVKNALQDALKDMRNPVDVYVFVDSEDSNCQYCSVTTKFLEFIASAAPKDGNGSLLKVHIVDRVNQNDR
    KIFEEFNVERVPTVAFYNGYIRWTGAPLGEEIRALVETIVRLSQGESGLSQETVEAIKSKLNGKVKIETVVTPS
    CPYCPY
    AALMAHMVAFEACRAGKCNVVSDVVEAYENQDIAEKYQVMSVPSIAINESVEFIGVPYEENFINAILEKQKIS

    >gi|227831278|ref|YP_002833058.1| protein of unknown function DUF395 YeeE/YedE [Sulfolobus islandicus L.S.2.15]
    MPSMVLQPVLQESWALIYGLFALSGFILGWAAQRGNYCFVNAMTSIFTAKSYERFGALLILFGLSALGSGLLVAFGVIPA
    FDQYYYNYFAGWYILIGSIIFGFGAALAGGCNLSMLYRAASGYVQNWIELFGMMIGTYVFAIGIWPFQLYTMANGILSTT
    NGGYVEYLPYIIFHSISNMSVYITTLVVSLPLIFIGIYLQQYTKRKWAISSSLRINLPAARAYYNQNISTSGEEKVSLTK
    EIKDLILLRKPYGTNLTTIILALDLLLVFIFGAGYTFNYLVITSSDGGRFFEYLLMLGNVKLFLNTPWFNDSLPIVDPST
    LMVIMLCIGAFSASYLSGDFKIRIPRNKSRLLIGFGGGMLVGIGVRMALG
    CNVGLMWTNFAQLGYDGIIFLFGMLLGVYL
    AIKVQERWL

    >gi|227831409|ref|YP_002833189.1| Rhodanese domain protein [Sulfolobus islandicus L.S.2.15]
    MSQVQEQQVIVDNKWVLDHLKDQKVRIVEVDYDPNTAYNVWHIPGAVLVRWREDLRHPVLRDFIEPSQFEKLMESKGISN
    NTTIVLYGDYNNWFAVYAFWLFKSYGHDDVRILNGGRTKWAKENLPTEQGAKEPQYPKGSYKVKKVDWGSHRAFFWEVLQ
    KITKGEVGRTTILVDVRSPKEYTGEIRAPPEYADEQTQVGGHIPGAVSFPWAQAVNPDTGEFKSIEELRRLVESAGITPE
    KEIITY
    CRIGERASHTWFVLKYLLGYPAVRVYDGSWAEWGNIVGAPVKKGTEP

    >gi|227831517|ref|YP_002833297.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Sulfolobus islandicus L.S.2.15]
    MPLKTFDTIIVGAGIAGLSAALYSSRQKLSTLVLSKDLGGQLTLTDLIENYPGIESTGGLSLAQKIEKQAKKFGAEFIYG
    EEVKEIAQESDVFIIKGIKGEYAGRAIILAFGKTPREINVPGEQEFKGKGVSY
    CAICDAAFFKGKPAAVVGEGEPGIEAI
    ELLSNYANPAYYITSSSYLAGEEEIVKNVLNKPNVKIFTSSKVLEIRGNSKVEEIMIKKGDEIISLRVDGVIIEMGYVLK
    TEFLKGFVELNEKGEIVVDELGRTSREGVFAAGDVTQTPYKQAVVAAAEGVKAALSAYNYIRSKKGLPPVNVDWKAEKKK
    VSFKL

    >gi|227831586|ref|YP_002833366.1| mercuric reductase [Sulfolobus islandicus L.S.2.15]
    MEDLVIIGYGAAGFAALIRANQLGIKPVVVGYGEIGGTCVNVGCVPSKRMLRIGELYNNSSKIVGKKLFPEFFQAFQDKA
    EIVNSLRKEKYEDVINSYDVKLIIGKAHFISPNAIKVNGETIEAKKFIIATGSSPNVPNIKGLTEVGFWTNVEALSPDKI
    ISSLAIIGGRALALEFAQMYKRLGVDTIILQRSERILPDWEPEISLSVKNYLEKNDNIPIFTNVRVKEVRKGNGGKIVVT
    DKGEVEADEILLATGRKPNVEMNLDAAGIELNDKGGIKVNEELRTSNPNVYAAGDVIGGPMLEALAGRQGSIAAENAIMN
    VKRKIDMSSVPQVVFIEPNVAKVGLTALEAMKEGYDIDHRVVKMNNIAKARILREDYGLIKMVIDKKFRNILGVQMFGKY
    AAEVINEAALAVKFRATIDDLIDIIHVFPTMAESLRIVALAFTSDVSKMSC
    CV

    >gi|227831624|ref|YP_002833404.1| heavy metal translocating P-type ATPase [Sulfolobus islandicus L.S.2.15]
    MVTEKKEELRITDKEEQLKIIGMHCATCVMSVSKSLKSVSGVKDAEVNLATGSAKVILSGNVRLKELVKAVRKAGYDVGT
    EKFTIKLNVNPEEMPKIERKFENVKGVVDVKSNLGLGIVSVEYNPESTTPEEILKEAGVKGEIINEQRSERSILYKDFYD
    LLKRLVIGITFTPLTYLFPFFLGILLSIPIQFYSGLRFHKGAYRALKNRTTNMDVLVSLASNILWFSGIFLHSTFYADAS
    LLITFILVGKTLEAYIKAKMSSEIRIEPYKATLKDGRVVNSNELKVGDIVIVRTGERIPADGIIESGEGEVNEAIITGEQ
    KPVLKRKGDNVLAGGILVNGYLEIYVTRNWDRSYIIQVIESVRGAYNARVSIQNLVDKVSSVFVPIVITLSALTFLVWKF
    VLGYNLYSSLFFSVAVLAAACPCALGLASPMAMLVSVRRALKRGIIIRDGSILEEIRNVNVAVLDKTGTVTEGEYVIVSK
    KEFINGALDLAAIAESRSIHPIAKAFHKMNMKDGKVEQFEEFPGRGIYARINGNDVIVGSKDFVKSNCDWNVEDEGDILV
    CINGRAGGIVNIRDKLRDDAKRVINYMKERGIMVIIATGDSSNYADEIGKELGIEVRKGLTPDNKAELVKELRENGNKVI
    FIGDGINDAIAMREADVGIAISSGTDLAKSAGKVVINSLDDVIGLFEQAKLGVRKIKENLAWAFGYNTVIIPIAAGLFYP
    TIYLPPEYAALAMGFSSVIVSLWSLVPI

    >gi|227831639|ref|YP_002833419.1| Rhodanese domain protein [Sulfolobus islandicus L.S.2.15]
    MMLITERRSPFYPNIQNVPPSVIRKLVKNKEIQLIDIRQPWEYEDHHIPGSILLPLDYFEDLFQLMLNKSNIGIICEHAN
    RSTWLVYTKPSLFKEVKVYNMLGGIELWMMMGYEVEKGMDDNGTLWYKLLTKNLR

    >gi|227831664|ref|YP_002833444.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sulfolobus islandicus L.S.2.15]
    MVEIGQKAPELELVDTDLKKVKIPSDFKGKVVVLAFYPAAFTSVCTKEMCTFRDSMAKFNEVNAVVIGVSVDPPFSNKAF
    KEQNKLNFTIVSDFNREAVKAYGVAGELPILKGYVLAKRSVFVIDKNGIIRYKWVSEDPTKEPNYDEIKDVISKLS

    >gi|227831708|ref|YP_002833488.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Sulfolobus islandicus L.S.2.15]
    MKVAVIGSGPAGIDASLELAKNNKVILVEKEERLGGTCVLYGCIPSKAMLHPIHLASELEKLGKSIVFDLGELRKLGQEA
    SFRLSKGVEYMLEDNGVEVIYGVASLRSGQLNVNNETLQTDYIVLATGTYREVVKGIIYSEDLPYLEKDFQSVVIVGGDV
    GGVEFGWMLRKLGKEVVLIDKQSSLLSYLDKEVSNAITNYFSKIGVKLYLNRSVKEMKEREVVLENGERLTADVVYMTFG
    RKPSIQGFEEVNHNPFVTVDEYLRTSISNVFAAGDIIGTHTAHEAMYAGKVAAINVMGGKKVFNKQGIPKVVYTHPTIAY
    VGNMEGKCAKINLAEIGRAITEKETDGFLKICVKDDKIVGAQAFMKDAEEVISLISFLIRYNIKVSEIKDYVAPHPSYIE
    AITELLSRL

    >gi|227831726|ref|YP_002833506.1| Rhodanese domain protein [Sulfolobus islandicus L.S.2.15]
    MTQVIESYSSPFYKNIIDLPPSMVRKLWKSGKIIILDIRTPQEYEDHHIPGAILAPLDYLEHLTELFEDREVAVVCEHGN
    RASYATYGMPHLYKKKAYYMIGGMALWMAMGYEVESGMDENGVLWQKILEMKFNY