Sulfolobus islandicus L D 8 5 uid43679

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|284996428|ref|YP_003418195.1| protein of unknown function DUF255 [Sulfolobus islandicus L.D.8.5]
    MNERLRNSQSGYLRKAVNHPINWYTWSNEIFEIAKREDKPILIDVGAAWCHWCNVMDEDTYSNPEIVKIVNENFIPVKVD
    RDEMPDLDRLLQNAAMAITGESGWPLTIFMTPEGKVFFGGTYFPPEDKYGRIGFKKLLLEILRIWREDRNQIFSSSIDPN
    MLIARNTGGVLSSSVLDDAFSYITSYFDIEYGGLGFGAKFPHPFVDLLFLNYSATRGDDLGKKLGLFTLRKMYYGGIFDQ
    VGGGFHRYTVDREWKLPHFEKLLIDNAELIYDYFTYYTATNDIEILDALRNSVDFVLRELYMDGKGFANSLDADSEGMEG
    KYYTWTEDELKGALGNDYGIAIRVFDLKNTVEVEGRKVLLRTTELRELSKVTGLQANEIIEKVSEIRAKLLTYREQNRKM
    PYRDDSTYTYPNAKLTESILFSSLILNKGIEEAKLVLSKLGKSVSRRLDGGKAGLPEDYAAALLASISAYEVLSEEKYYD
    LAIELGRNIGGIRPNNFTDMPNESANSMYIRALFKLSLLSDEFKVDEGKIKPLIPSLTAENSQFIAGIVNTISSYINGMA
    HIVVVDEKDGLAERLHRTALLTYYPFKLIERVDDSRTDYVSSVIRAMIKYNAGKSRAYVCIGNTCSMPVSEEEKIKQLLK
    TKL

    >gi|284996457|ref|YP_003418224.1| thioredoxin [Sulfolobus islandicus L.D.8.5]
    MNDELNDPELQKILSKKANQILNSLKEKVEEPVKHLNSKNFEEFITKNKIAVVDFWAEWCAPCFILAPIIEELANDYPQV
    AFGKLNTEENQDIVMKYGIMSLPTVMFFKNGEPVDQILGAVPREEIEVRIKALLE

    >gi|284996475|ref|YP_003418242.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sulfolobus islandicus L.D.8.5]
    MNVGEEAPDFEAESTLGKIKLSDFRGKKVILYFYPKSFTSGCTRELQRFTELYDEFKKLNAEVIGVSVDKIDTQKKFAEK
    YGAKFPIVADAQKTISKLYSVLNERGTSAQRVTFIIDENGKIVDILKNLKKAEEHADKSLEIIKEQNST

    >gi|284996499|ref|YP_003418266.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Sulfolobus islandicus L.D.8.5]
    MERLIIIGGGAAGMTASSWARRLKPNIDITVFESTKMVSHAPCGIPYFTEGLFDDENLFMTYTPEYFVEKRKINVKINSK
    VEEVDLRSRTITVRENQENKKYEFDYLLLSTGAKPKKLNAEGDRIFYVHHPADASYIRQKLWSFDRIAIIGGGILGIEMA
    EALRARGKKLVLIHRGKYLLNKMLDEDMGKIITDKVGSEIELKLNESLISVTERGRLIVTDKGKYEVDATVVGIGVEPNV
    DLVKDQLKIGETGAIWADNHMRTSFENVYAAGDSTESINIITKKPDWVPFAPVANKMGFVAGNNIGGKDVTFPGVIGTMI
    TKFEEYVIAKTGITENEAKRHNIKTVSATVHHKTRARYYPGSKDIIVKLIAEANTMRIIGAQIIGEEEVLGRLNMMAAVI
    QKGFTAEELFFVETGYVPPVNRVWDAITLAARKLYTGISGE

    >gi|284996615|ref|YP_003418382.1| thioredoxin reductase [Sulfolobus islandicus L.D.8.5]
    MSLLPRTASVKPGERFDVIIVGLGPAAYGAALYTARYMLKTLVIGETPGGQLTEASIVDDYLGLIEIQASDMIKVFNKHI
    EKYEVPVLLDIVEKIENSGDGFVVKTKRKGEFKADSVILGIGVKRRKLGVLGEQEFVGKGISY
    CSVCDAPLFKNRVVAVV
    GGGDSALEGAEILSSYSTKVYLIHRRDSFKAQPIYVETVKKKPNVEFVLNSVVKEIKGDKVVRQLVVENLKTGEIKELNV
    NGVFVEIGFDPPTDFAKSNGIETDTNGYIKVDEWMRTSVPGIFAAGDCTSMWLGFRQVITSVAQGAVAATSAYRYVTEKK
    GKK

    >gi|284996686|ref|YP_003418453.1| methylated-DNA--protein-cysteine methyltransferase [Sulfolobus islandicus L.D.8.5]
    MLVYGLYKSPLGYITVAKDDKGFIMLDFCDCVEGNSRDDSSFTEFFHKLDLYFEGKPINLREPINLKTYPFRLSVFKEVM
    KIPWGKVMTYKQIADSLGTSPRAVGMALSKNPILLIIP
    CHRVIAENGIGGYSRGVKLKRALLELEGVKIPE

    >gi|284996736|ref|YP_003418503.1| conserved hypothetical selenoprotein [Sulfolobus islandicus L.D.8.5]
    MQDPVCKMEVENTTPYRINYRGITYYFCSKGCLDEFKKNLTKYVSPADLNKKIDVKIVYCRPCKYMDRALNLARDILSYF
    EEVNVELVQGDRGILDIYVNDELVFSRYIEKRFPESEEILKSIGQKLQLARQS

    >gi|284996737|ref|YP_003418504.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Sulfolobus islandicus L.D.8.5]
    MREKSCDYLIIGSGIAGYNALKELLELKPNSKIIMVSSDKYYPYDTPPLSKYYLRGEMAREKLFFESEDFYKRGNLDVVL
    NRSVERIDTDSKEAVLNDGSVISFDRALIASGGRPRRLSVPGGENALYLRTLDD
    CDGIREVASRSRNALIIGAGFIGVEV
    ASSLTTLGVRTTVVEVMPYIWNTFVDEKVSMVIRQYLEGKGISFILDESVREIQGKAAITSGGKRLEADMFLIAVGIVPN
    VEVAQKSGIQVDNGIIVNEYLETSAKDIYAAGDIANIFDPREGRRKRIEHWNNAEYTGKLAARNMAGNREAYNFISSIWS
    DIFDIHIESAGETRNYDEYVIRGRFNSDNPNFNVIYLKGGIVKGYVAINRDYGELEVLNKLIKEGKDVSNKKNSLADEGF
    DLKELLK

    >gi|284996753|ref|YP_003418520.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sulfolobus islandicus L.D.8.5]
    MSEGRIPLIGEKFPEMEVITTHGKIKLPDDYKGRWFVLFSHPGDFTPVCTTEFYSFSKKYEEFKKLNTELIGLSVDSNIS
    HIEWVMWIEKNLKVEVPFPIIADPMGNVAKRLGMIHAESSTATVRAVFIIDDKGTVRLILYYPMEIGRNIDEILRAIRAL
    QLVDKAGVVTPANWPNNELIGDKVINPAPRTIKDAKMRLGQPFDWWFTYKEVKTT

    >gi|284997004|ref|YP_003418771.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sulfolobus islandicus L.D.8.5]
    MVKVGDKAPLFEGIADNGERISLSHFIGKHNIVIYFYPKDDTPGCTREACAFRDNWDLLKDYDVVVIGVSSDDINSHKKF
    KEKYKLPFILVSDPDKKIRELYGAKGFILPARITFVIDKKGIIRHIYNSQTNPANHVNEALKTLKQIKAEEIS

    >gi|284997308|ref|YP_003419075.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Sulfolobus islandicus L.D.8.5]
    MKVVIIGAGPAGVYSALTLSKNAKVTLIEKEEKLGGTCVLYGCIPTKSILSQLIISRQASNMSLNTFREYALASINTISK
    SLEQLLNSHGIEVIHANGFLRSSMVHASNTSLTADKVLVSTGTRRERLGKVKFTEDLAYTNEDYNKVVIVGGDAGGIELA
    WMMKKLDKEVHLIDKNDLLLQNIDNTLSEVVTNFLSHIGIKLYLGKKVSKIDETSVTLEDNQTISGDAVFVTFGRKPNIE
    GFEEIPHEKYIYVDEYLRTQIPNIYAAGDIIGTFTAHEAIYGGIIAAKNMLGEKREFLVEGIPKVIYIYPQIAYVGTTIG
    NCVTFNTLNLTRTVVEREGEGFLKICERDNRVIGGVAFMPYAEDVISLISVLIRYQINLKDTIDLVMPHPSYLEAITEAL
    NMLQSKE

    >gi|284997435|ref|YP_003419202.1| Radical SAM domain protein [Sulfolobus islandicus L.D.8.5]
    MIPISVLVTNAGTVSFHIKGEYNKDRPSKFSDVFRPVVTWNLTRKCNLKCLHCYINASPEGEDGSTTEEALRLIDEMAEM
    RIPLIIMSGGEPLMRRDFFELASYARIKGIKLALSTNGTLITESVAKKLKELDFSYVGISLDSYDPEFHDKFRGLNGAFN
    MTVKGIKNAINVGLNVGLRFTITARNIHQIDEYVKLALELGVKRITFYHLSASGRGKELREWMYTPEEYVGFINKMIDYA
    IKLSGKIEIETTLGQFDGVYIAKKLARDEEELEKYMKFVENSGGCGRKMISIYPNGDVYPCQFIDFYKLGNVREKPLKEI
    IKNIPDLFINTDKYLRGEYCDKCKYKSA
    CKGGDRARAYYWNGDVYGDDPLCPLKTLHI

    >gi|284997495|ref|YP_003419262.1| DsrE family protein [Sulfolobus islandicus L.D.8.5]
    MAQAQTQGQEEEQKKKILIVVTHGPEDLDRTYAPLFMASIAASMEYETSVFFMIKGPKLLDKKWQEEERKKGGNPFIHFF
    DMAKDNGVKMYV
    CVQSLKDMCHMKEDDVVEGIELVGGSTLIDLTMEADRTLFF

    >gi|284997496|ref|YP_003419263.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Sulfolobus islandicus L.D.8.5]
    MKYDIVVIGGGTAGYVAGSILARKGKKVIVIEKEKFGGVCVNFGCVPSIFLFDVTFLLNRFKEIVYYLGLDGEIEYKDLL
    FSKRNEIVNYLSNAGRRLIEDSGGETELGEAEIISPSEVKVNGRIVEFDKLIIATGSKPMIPNIDGIEDAISEDDAVNLN
    SIPSSMVVIGGGYAGVEIAQIYSRLGSQVTLLSRSEILPTFPEDVRSVVKDSLEFDGVNVVENTRIVKLRDGKVITEKGE
    IEGNVVVYATGRRPQLPKGIEKLGLEIDECGINVDKYKQIKNNAYAIGDVINKERKTAHSAMFDALVASLHILKETAFIP
    PDNFKIPVVLYTDPQVGVIGDHKEAKKFSVFPFAAITRAIINGIKDGYVKIGINERNEIVFGEVIGDKAEELINILTLVV
    NNRMRIESLALMPFVHPSLSEAIVNAAKGFFDLDVDRYKSKDGKT

    >gi|284997498|ref|YP_003419265.1| glutaredoxin related protein [Sulfolobus islandicus L.D.8.5]
    MSYDYVIKEYLNAIKKGDITIQHCNGDDLFHEFKNYVKVETLDNCKKPLVKVKKGDRVYYTYYGIPIANELWPFLNSLVR
    ISNNIVNLDEKEMELARQVRGNVKLFVTPD
    CTKCPITAEFLYQVSQINENVKLEIYDTAEYEEERDKYRILSVPKIIFNE
    KVEIPGGFPSTMILKMMLKALQSELR

    >gi|284997540|ref|YP_003419307.1| DSBA oxidoreductase [Sulfolobus islandicus L.D.8.5]
    MVVKITFFHDVLCPFCFVTSRRLRSVARKFNDEIVVKHKAFMIISSLDDLKAAAPTEEEARELFKQEFSIIKRYFPDYDP
    EKVIGKGKITWVWSLPPLMACKAAEYQRGDNGYWDYFDKAQERFFLEGENVNDDNVLIQIAEELGLDIEKFKEDFKSKKA
    RMSVYEDEAEAHAMGIRGVPALLVNDYWLIRGVQDETYLESVIEDLLSNGGEPKKVKLKAYWEAT

    >gi|284997553|ref|YP_003419320.1| hypothetical protein LD85_1279 [Sulfolobus islandicus L.D.8.5]
    MTTITFTAEGKLERDKVIVDLNGTEIRVGLLGSDNPTPEEFCLASAISCLILTVYYIAREKGVAINSIEGYIEGKMDTKG
    FQGFKEVPPGLLEVNYELIVDSKDTRISEILKEAEERCPMRDTLTRSVKVNINWKIKRS

    >gi|284997593|ref|YP_003419360.1| Thiosulfate sulfurtransferase [Sulfolobus islandicus L.D.8.5]
    MLVSVEWLNNNLKDVKVVEIGYNPQINYYEGHIPGAVLINWRDFLDDNSRDFASPGKLSKVLGNAGINNDDLIVLYSEMN
    NRYAFYVYWILKAYGHSNLAILNGGIYKWLKEGYPIESDGMVVNKKSEYKARKPDWSSRILVWELLSKLKEFVLIDSRSK
    EEYDGLTTAPPEHKCEQTQMSGHIPGAKNIPWTILLNEDETMKSRDELERIFSWLSKEDKIVVY
    CRTGARASVAWYALKE
    VLGFKLVRLYDGSWVEYGNMVGVPVEKSVSDRF

    >gi|284997597|ref|YP_003419364.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Sulfolobus islandicus L.D.8.5]
    MILILGGGFAGVSAYNQNKENSLVVDRKDYFLLTPWIIDFICGMKKLEDIIVKYKKVILGNVQKIDFKNKKVILDNSKEL
    TYDKLIVSLGHHQNLPRLKGAKEYAHKIETLEDAIELKRRLNEVKDITIIGGGATGVELAGNIKGKKITLVQRRNRLLPT
    MSTASSKKAEDLLRELGVNLMLGVEAIEIKKDSVVTSYGEIKTELTIFAGGLKGPQIVGNLHANKNHRLLVDKNLKSIEY
    NDVYGAGDCVTFEDKEIPMTADIAVAAGRVVMKNILGNEIEFKPKRLATTIRIRNEFFGDFGENYVEGKFAKILKDISYL
    ESLLLPRRLRE

    >gi|284998249|ref|YP_003420017.1| thioredoxin [Sulfolobus islandicus L.D.8.5]
    MSEIDSLIREVAERLQKKAEEYGKKKEDATLVLTEENFDEVIRNNKLVLVDCWAEWCAPCHLYEPIYKKVAEKYKGKAVF
    GRLNVDENQKIADKYSVLNIPTTLIFVNGQLVDSLVGAVDEDTLESTINKYLE

    >gi|284998302|ref|YP_003420070.1| hypothetical protein LD85_2047 [Sulfolobus islandicus L.D.8.5]
    MEVQIFTHKNCVECNMLLEYLENKGLLGKVKIIDTELYPFLAFERGVISTPSIFIDGKLVYAGIVDFEEFERILSGEKVT
    RQIDKDKLVEKLMLGIVDSFAATAWLYINRDFDSFLAQKDFVMAVTGLSLLDEKEREEYYNYLRNIMIKEGEKYLEEWKP
    RMLRNISSNFIREIFWLYETKISKEVVMQKYSVEVFAHWLMVRGGAVGRVGLRIYPLSDSTLMRRVLEAYNFMLGNYDDI
    FNKVQKEQTELKAKNREQVRYLQI

    >gi|284998316|ref|YP_003420084.1| hypothetical protein LD85_2061 [Sulfolobus islandicus L.D.8.5]
    MITFLLAFSATCLNLSNSSIDIGVPSLPPPFSIGTISIPTFSRQHLFLKIILHYNLVERYSRQLLVLGLGVQQRLNELKI
    LIAGCGALGSAIAELLARLGVGEITVVDADVVDVTNLHRVHLFDENDVGKPKAEICAKKLSLINSSIKINYIIDILDEQN
    VEKLISDKDYVFDALDSLYYKLLLNDATVKLRKILIYGGINGEYGSVKLIDSNQTSCLSCFINYSDQDEIGNS
    CNVIGTT
    PLIVELTATLQVNLMLNHLRGNPDYSLFYIDSRELKIERINIEKNFQCKTCVLNEYPFLNQKITKPNCGIFRVNMKVTEL
    DKPKVFKNIGNAILCYPNIGCFEKRGR

    >gi|284998451|ref|YP_003420219.1| Glutaredoxin-like domain protein [Sulfolobus islandicus L.D.8.5]
    MEQEYAELFSDEVKNALQDALKDMRNPVDVYVFVDSEDSNCQYCSVTTKFLEFIASAAPKDGNGSLLKVHIVDRVNQNDR
    KIFEEFNVERVPTVAFYNGYIRWTGAPLGEEIRALVETIVRLSQGESGLSQETVEAIKSKLNGKVKIETVVTPS
    CPYCPY
    AALMAHMVAFEACRAGKCNVVSDVVEAYENQDIAEKYQVMSVPSIAINESVEFIGVPYEENFINAILEKQKIS

    >gi|284998788|ref|YP_003420556.1| protein of unknown function DUF395, YeeE/YedE [Sulfolobus islandicus L.D.8.5]
    MPSMVLQPVLQESWALIYGLFALSGFILGWAAQRGNYCFVNAMTSIFTAKSYERFGALLILFGLSALGSGLLVAFGVIPA
    FDQYYYNYFAGWYILVGSIIFGFGAALAGGCNLSMLYRAASGYVQNWIELFGMMIGTYVFAIGIWPFQLYTMANGILSTT
    NGGYVEYLPYIIFHSISNMSVYITTLVVSLPLIFIGIYLQQYTKRKWAISSSLRINLPAARAYYNQNISTSGEEKVSLTK
    EIKDLILLRKPYGTNLTTIILALDLLLVFIFGAGYTFNYLVITSSDGGRFFEYLLMLGNVKLFLNTPWFNDSLPIVDPST
    LMVIMLCIGAFSASYLSGDFKIRIPRNKSRLLIGFGGGMLVGIGVRMALG
    CNVGLMWTNFAQLGYDGIIFLFGMLLGVYL
    AIKVQERWL

    >gi|284998942|ref|YP_003420710.1| Rhodanese domain protein [Sulfolobus islandicus L.D.8.5]
    MSQVQEQQVIVDNKWVLDHLKDQKVRIVEVDYDPNTAYNVWHIPGAVLVRWREDLRHPVLRDFIEPSQFEKLMESKGISN
    NTTIVLYGDYNNWFAVYAFWLFKSYGHDDVRILNGGRTKWAKENLPTEQGAKEPQYPKGSYKVKKVDWGSHRAFFWEVLQ
    KITKGEVGRTTILVDVRSPKEYTGEIRAPPEYADEQTQVGGHIPGAVSFPWAQAVNPDTGEFKSIEELRRLVESAGITPE
    KEIITY
    CRIGERASHTWFVLKYLLGYPAVRVYDGSWAEWGNIVGAPVKKGTEP

    >gi|284999069|ref|YP_003420837.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Sulfolobus islandicus L.D.8.5]
    MPLKTFDTIIVGAGIAGLSAAVYSSRQKLSTLVLSKDLGGQLTLTDLIENYPGIESTGGLSLAQKIEKQAKKFGAEFIYG
    EEVKEIAQESDVFIIKGIKGEYAGRAIILAFGKTPREINVPGEQEFKGKGVSY
    CAICDAAFFKGKPAAVVGEGEPGIEAI
    ELLSNYANPAYYITSSSYLAGEEEIVKNVLNKPNVKIFTSSKVLEIRGNSKVEEIMIKKGDEIISLRVDGVIIEMGYVLK
    TEFLKGFVELNEKGEIVVDELGRTSREGVFAAGDVTQTPYKQAVVAAAEGVKAALSAYNYIRSKKGLPPVNVDWKAEKKK
    VSFRL

    >gi|284999138|ref|YP_003420906.1| mercuric reductase [Sulfolobus islandicus L.D.8.5]
    MEDLVIIGYGAAGFAALIRANQLGIKPVVVGYGEIGGTCVNVGCVPSKRMLRIGELYNNSSKIVGKKLFPEFFQAFQDKA
    EIVNSLRKEKYEDVINSYDVKLIIGKAHFISPNAIKVNGETIEAKKFIIATGSSPNVPNIKGLTEVGFWTNVEALSPDKT
    ISSLAIIGGRALALEFAQMYKRLGVDTIILQRSERILPDWEPEISLSVKNYLEKNDNIPIFTNVRVKEVRKGNGGKIVVT
    DKGEVEADEILLATGRKPNVEMNLDAAGIELNDKGGIKVNEELRTSNPNVYAAGDVIGGPMLEALAGRQGSIAAENAIMN
    VKRKIDMSSVPQVVFIEPNVAKVGLTALEAMKEGYDIDHRVVKMNNIAKARILREDYGLIKMVIDKKFRNILGVQMFGKY
    AAEVINEAALAVKFRATIDDLIDTIHVFPTMAESLRIVALAFTSDVSKMSC
    CV

    >gi|284999177|ref|YP_003420945.1| heavy metal translocating P-type ATPase [Sulfolobus islandicus L.D.8.5]
    MVTEKKEELRITDKEEQLKIIGMHCTTCVMSVSKSLKSVSGVKDAEVNLATGSAKVILSGNVRLKELVKAVRKAGYDVAT
    EKFTIKLNVNPEEMPKIERKFENVKGVVDVKSNLGLGIVSVEYNPESTTPEEILKEAGVKGEIINEQRSERSILYKDFYD
    LLKRLVIGITFTPLTYLFPFFLGILLSIPIQFYSGLRFHKGAYRALKNRTTNMDVLVSLASNILWFSGIFLHSTFYADAS
    LLITFILVGKTLEAYIKAKMSSEIRIEPYKATLKDGRVVNSNELKVGDIVIVRTGERIPADGIIESGEGEVNEAIITGEQ
    KPVLKRKGDNVLAGGILVNGYLEIYVTRNWDRSYIIQVIESVRGAYNARVSIQNLVDKVSSVFVPIVITLSALTFLVWKF
    VLGYNLYSSLFFSVAVLAAACPCALGLASPMAMLVSVRRALKRGIIIRDGSILEEIRNVNVAVLDKTGTVTEGEYVIVSK
    KEFINGALDLAAIAESRSIHPIAKAFHKMNMKDGKVEQFEEFPGRGIYARINGNDVIVGSKDFVKSNCDWNVEDEGDILV
    CINERAGGIVNIRDKLRDDAKRVINYMKERGIMVIIATGDSSNYADEIGKELGIEVRKGLTPDNKAELVKELRENGNKVI
    LIGDGINDAIAMREADVGIAISSGTDLAKSAGKVVINSLDDVIGLFEQAKLGVRKIKENLAWAFGYNTVIIPIAAGLFYP
    TIYLPPEYAALAMGFSSVIVSLWSLVPI

    >gi|284999192|ref|YP_003420960.1| Rhodanese domain protein [Sulfolobus islandicus L.D.8.5]
    MMLITERRSPFYPNIQNVPPSVIRKLVKNKEIQLIDIRQPWEYEDHHIPGSILLPLDYFEDLFQLMLNKSNIGIICEHAN
    RSTWLVYTKPSLFKEVKVYNMLGGIELWMMMGYEVEKGMDDNGTLWYKLLTKNLR

    >gi|284999218|ref|YP_003420986.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sulfolobus islandicus L.D.8.5]
    MVEIGQKAPELELVDTDLKKVKIPSDFKGKVVVLAFYPAAFTSVCTKEMCTFRDSMAKFNEVNAVVIGVSVDPPFSNKAF
    KEQNKLNFTIVSDFNREAVKAYGVAGELPILKGYVLAKRSVFVIDKNGIIRYKWVSEDPTKEPNYDEIKDVISKLS

    >gi|284999266|ref|YP_003421034.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Sulfolobus islandicus L.D.8.5]
    MKVAVIGSGPAGIDASLELAKNNKVILVEKEERLGGTCVLYGCIPSKAMLHPIHLASELEKLGKSIVFDLGELRKLGQEA
    SFRLSKGVEYMLEDNGVEVIYGVASLRSGQLNVNNETLQTDYIVLATGTYREVVKGIIYSEDLPYLDKDFQSVVIVGGDV
    GGVEFGWMLRKLGKEVVLIDKQSSLLSYLDKEVSNAITNYFSKIGVKLYLNRSVKEMKEREVVLENGERLTADVVYMTFG
    RKPSIQGFEEVNHNPFVTVDEYLRTSISNVFAAGDIIGTHTAHEAMYAGKVAAINVMGGKKVFNKQGIPKVVYTHPTIAY
    VGNMEGKCAKINLAEIGRAITEKETDGFLKICVKDDKIVGAQAFMKDAEEVISLISFLIRYNIKVSEIKDYVAPHPSYIE
    AITELLSRL

    >gi|284999288|ref|YP_003421056.1| hypothetical protein LD85_3094 [Sulfolobus islandicus L.D.8.5]
    MTQVIESYSSPFYKNIIDLPPSMVRKLWKSGKIIILDIRTPQEYEDHHIPGAILAPLDYLEHLTELFEDREVAVVCEHGN
    RASYATYGMPHLYKKKAYYMIGGMALWMAMGYEVESGMDENGVLWQKILEMKFNY