Sulfolobus acidocaldarius DSM 639 uid58379

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|70605894|ref|YP_254764.1| thioredoxin [Sulfolobus acidocaldarius DSM 639]
    MPETKSSPVIELNSSNFNSFVESHKIAVVDFWAEWCAPCFVLSPIIEELASEYTQIGFGKVNADENSDIANQFGIMSLPT
    VLIFKNGKVVDTIVGAVPRDTIENKLKSVLGE

    >gi|70605910|ref|YP_254780.1| 2-cys peroxiredoxin [Sulfolobus acidocaldarius DSM 639]
    MALEKGNEAPDFEGDSTIGKLKLSSYRGKSVVVLYFYPKAFTPGCTRETIKFGQLYDQFKQLNAEVIGVSVDTVSTQKSF
    ADKCGARFPIVSDSNKQIAKLYGVLNEKGSSAQRVTFIIDENGKIIEVLSGLGNAEEHANKSLEIIKRIRGKT

    >gi|70605982|ref|YP_254852.1| dihydrolipoamide dehydrogenase [Sulfolobus acidocaldarius DSM 639]
    MRIVVIGSGPAGLYSAITSSSLGNKVTLVEKEDRLGGTCVLYGCIPSKAMLHPLILSSGIEKVKGNSKIEFNFKEISELG
    INAVNRVSKGTEYMLEKYNVDIIHGRAILKGNSVEVNGQTLSSDKIIIATGTVKPQVQGSIASDDLPYLDRDFQKVVIIG
    GGVGGVEYGWLLRALGKEIFVVEKENLLLPRHDPDLRNSVTYTFRKMGFSLLLGKEVKKIERNKVVLDDGKEIEGDIILM
    SFGRTANVNGFEGVPHDKWIKVNEFMETEIRGVYAAGDVTGSFTAHEAISKGITAGYNASGIASRYRSDGIVKVIYTKPQ
    IAYVGDTTRGKCVKLNMASLTRAIAEKETEGFVKVCVEDDKVIGAVAFSERAEEIVSVLGLAIRYNIKVKELAEYPFPHP
    SYLETINEIMRELK

    >gi|70605993|ref|YP_254863.1| NADH peroxidase [Sulfolobus acidocaldarius DSM 639]
    MEKLVVVGGGAAGMSASSKVRRLKPEMDIEVFESTKFVSHAPCGIPYFIEGLFDDESLFMTYTPEFFKEKRKIDVKTGIR
    ITEIDFSGRTIYGETANKEKIKREYDYLLLSTGAKPKKVETEGNERVFYVHHPADALELRKQLWSLNTVAIIGGGILGLE
    MVEALVERGKKVVLIHKGDYLLNRSLDNELGKIITSIVMKDAEVKLNERLEVIKRGGRLVVTDKGNYEVDGTVVAIGVEP
    NVDLVKGKLTLGDTGAIKVDRHMRTTLKDVYSAGDNTEVVNLLTGRPQWVPFAPVANKMGYVAGSNIGGKEMTFPGTVNT
    QVTKYKDYYIARVGLNEEEARKHGFHVISASINSKTRARYYPGGGDIYVKIIADEESRKILGGQIIGVEEVLGRINMLAG
    MLYKGFTIDDVFFTEMGYLPAINRVWDPVIVAIRRLMKDD

    >gi|70606021|ref|YP_254891.1| dinucleotide-utilizing enzyme [Sulfolobus acidocaldarius DSM 639]
    MERYARQLLVLGLGVQEKISQLKIAIVGCGALGTTLAELLARLGVGKIKLIDADIVEVTNLHRTHLFEESDIGKPKATVC
    AEKIRKINSGIKVEVVNDIIDSNNAEEMLKDSDYIFDALDNLYYRFLLNDVAVKLRIPLVYGGVMGEYSSVMLIVPREGP
    CLRCFMNYDEHENEVNA
    CETIGTLDTVISITASLQVQLMLNHLRNQANLHSLYYLDTRELRIDNVKISKNDKCPTCSLER
    FDFLDGRMKQPSCGLSRLDIESHEFLVRDEENGNLVICYPSGKCFKKSNR

    >gi|70606035|ref|YP_254905.1| hypothetical protein Saci_0193 [Sulfolobus acidocaldarius DSM 639]
    MSKVEIFTHKTCTECGILMEFLERNKLLGKVTIIDTELYPFLAFERGVISTPSIFVDGKLVYAGVVDYDELLKILQDKKV
    IVEVNKDELVNKLMFGVVNSFAATAWLYVNRDFDALMAQKDFVLAVTGLSLVDDKSADEYYTYLRNIIVKEGEKYVDEWK
    EKMLRVIATNFIRELYLLYRKKLSDEEIMRKYPLEVFAHWLMIRGGAVGRVGLRIHPLSDNQVLEKISEVYVYTLSNAKQ
    LWDKVIKEQEELAKKSALYEQARFISI

    >gi|70606040|ref|YP_254910.1| hypothetical protein Saci_0198 [Sulfolobus acidocaldarius DSM 639]
    MNRLGNVSSAFLKLSSESPIDWFPWSDEAFDKAKKEDKPVLVDVGASWCHWCHVMDETTYEDKEVIDLINKNFVAIKVDR
    DEMPDLDRRLQLAVSSITGESGWPLTVFMTPDGKVFFGGTYFPPEDSYGRVGFKRLLNEIIRLWKNERDKIFQTANSLHS
    SLQNLGYQKVEAQWDQVESIVSYIASNFDFQNGGLLGSMKFPHPTIDQLLIAYSFYTKSDTEAKLSMFTLKKMYYGGIFD
    QVGGGFHRYTVDNEWYVPHFEKLLIDNAELLISYTQAYMQSEDIEILDAMNMTVNFILRELSTVDGFSNSVDADSEGVEG
    FYYTWTLKEFQEALGGEDINFWIRFFNVDTGKEVEGRKVLRRNYDLRELSKRFKDPIGKLNDVRERLRVYREERRKYPFI
    DTNVYTHSNCRTAEALTLAYPITGKGLNEALKVIDMINTKITRRLTGGKDGLPEDYASALLALLSAYEVTGKMKYRDLAL
    RIGRELKEMDYNYPIDSPNESNASLANKGLLKLSLLDESFKFTPNSYSIDSPYIAGVTFNSMAFEKGLAHIVVVDEKDGK
    AKDLHLSALKIYHPFKVVELVSEDSIDMLPSFIKSMVNYNKGSSRVYVCIGNTCNLPVDSSEKIRLLLGGKT

    >gi|70606176|ref|YP_255046.1| hypothetical protein Saci_0337 [Sulfolobus acidocaldarius DSM 639]
    MEQAQSESQAEEQKKKILIVVTHGPDDIDRTYAPLFMASISASMEYETSVFFMIKGPKLLDKKWQEEERRKGGNPFIRFF
    DMAKENGVKMYV
    CVQSLKDMCHMNESDIVDGVEIVGGSTLIDLTMDADRSLFF

    >gi|70606177|ref|YP_255047.1| dihydrolipoamide dehydrogenase [Sulfolobus acidocaldarius DSM 639]
    MEYDVVVVGGGTAGYIAGSILARKGKKVLVTERERFGGVCVNYGCVPSIFFYDVTYFLNRGKEIGNYLGIEIETKESKRF
    FLRRDELVSYLSDAGKRLIENAGGDTEIGETRILTNNRVKVNGKEIDFKRIIIASGTKPLKPEIQGIENAISEDEAVRLN
    YIPSSVVIIGGGFAGIELAQYFSRLNSNVTLITRGKILRTFPEDAVNFLRQSLEFDGVKLIENTRVTNISKRIVETNKGN
    FEGEVVVYATGREPDLPKGIENIKVITGKNGVITNERLRAGENVYAVGDVVDKANKTAHSAMLDAIICSMDILGIAHANV
    KGIKIPRVLYTDPQIGVIGDINDAVKFGYFPFNASTRAIISGNREGYVKIGINEKNEIVFGEVIGEKAEELINILTLAVN
    SKMTVEQLSLIPFVHPSLSEAILNSAKSFFDLDVDRYKENNDFK

    >gi|70606179|ref|YP_255049.1| hypothetical protein Saci_0340 [Sulfolobus acidocaldarius DSM 639]
    MSYDNIIREYTRAIKSNITIYYCDGEELINYLKDVVVTKQLEECQKPLIKVQKDNRTYFTYYGIPTANELWPFLNALARI
    SNDIVQLDQKEIELAKGIRGNIKLFVTPD
    CTKCPITAEFLYQLVQINPDVTLEIFDVTEYEYEKEKYRVLSVPKIVFNER
    TEIPGGFPSTIILKMMIKALEKT

    >gi|70606226|ref|YP_255096.1| hypothetical protein Saci_0387 [Sulfolobus acidocaldarius DSM 639]
    MPTNVKIVYCRPCGFLDRALNLARDLLSYYEGVNVELEQGKNGIFDVYVDGQLIFSRFKEKRFPDSQEILKELSKKATAQ


    >gi|70606584|ref|YP_255454.1| hypothetical protein Saci_0791 [Sulfolobus acidocaldarius DSM 639]
    MEGEFAELFTDEIRQALIDALKDMKSTVQVHLFIDSKDPHCHYCEVTEKFLNFVKDASPKDNAGKSLLQVMVVDRANPDQ
    AKTFEEFEVTRVPTVAFLGGKLRWTGAPLGEEIRALIETIVRLSQGESGLSKETVNAIKEKLNGFTRITTVVTPS
    CPYCP
    YAALLAHMVAFEACKVGKCNVISEVVEAYENQDIAEKYQVMSVPTIAINDSVEFIGVPYEENFINTILEKQSEKQ

    >gi|70606661|ref|YP_255531.1| truncated copper-transporting P-type ATPase [Sulfolobus acidocaldarius DSM 639]
    MPNYRISKEEELKVVGMHCATCVETVTKAILSVQGVKDASVNLTSGEAKIVIEDNKKLKNVIQAIRKAGYDIITQEFIMK
    LNINQDEIGKVKDIIENIDGVISVKVGMERVIVEINPLSVSPEVILDELNRKGYKANIETEKIAKKSEYKDFLVRLLVAV
    FTTLPLLFINNIVLQLVLSIPTQFYSGYPFHRGMIRAIRNRTTNMDVLVSLSSNTAWIYSLIQIFIGKEPFFLTSSSLIT
    FILIGKLLEAFLKEKISEDVIKLTQVKARKIENGKEYEINSNELKVGDLVVVKTGDIIPADGVVESGEATVDESIYTGEA
    LPTTKKKGDPVIGGSIVQTGALTVYVTRSGNRAYISQVVSAIKEAEFTKLPIQKLVDKVSSIFVPFVIVISVLSSIFWYY
    IFHADFTFSLLIGIAVLASACPCGFGLATPTAIMIGIRKLAKTGIIVRNGDALQRLNETKRVIFDKTGTITSGKIKIIKT
    EGDIQLASALESLSNHPIAKAIAQLHSDMTEKKIEDFTEFQGQGVYGKVNGHEIIVGKKEFVLNNCQTDEIVDDADILVC
    KDGKLEGKIWISDEIRPEAKMVIEYLKKHGYDVEIATGDSSKFADEVAKSLGVKLHKGLSAEEKAELVREKPTVFIGDGV
    NDAIALKESHVGIAISSGTDIAKYAGDIIISNLSQLPYLLSQSTRIVRKVKENVLWALVYNIILMPLAAGLLYPHIYISP
    EIAALAMSMNSVSVVLWSLVQ

    >gi|70606716|ref|YP_255586.1| thioredoxin reductase [Sulfolobus acidocaldarius DSM 639]
    MSLLPKVFNVKEGEKYDTIIIGLGPAAYSAALYAARFMLKTLVIGETPGGQLTEAGEVDDYLGLIGINAQDMIKVFNKHI
    EKYEVPVLLDIVEGFKREGDEFVVKTKRKGEYKADTLILAIGVKRRKLNVPGENEFAGRGVSY
    CSICDAPLFKNRTTVIV
    GGGDSALEGAEILSRYSNKVYLVHRRDQFKAQPIYVELVKKKPNVEIILNSVVKEIKGEKLVKSVVIQNINTGETREIQT
    NGIFVEIGFEPPTDFARAHGIEVDNNGYIKVDEWMRTNVEGVFAAGDCTGMWLGFRQIITATAQGAVAAHAAFNYLNQRK
    KKK

    >gi|70606900|ref|YP_255770.1| peroxiredoxin [Sulfolobus acidocaldarius DSM 639]
    MPEVGEKAPEIELVDTDLKKWKIPTDFKGKVVVLAFYPGAFTSVCTKEMCTFRDSLSKFNELNAVVLGISVDPPFSNKAF
    KEQNKINFPLLSDFNRVAVKAYGIAGELPILKDYVISKRSVFIIDKDGVIRYKWVSDNPGIEPNYEEIKQVVAKLSGK

    >gi|70606939|ref|YP_255809.1| thioredoxin reductase [Sulfolobus acidocaldarius DSM 639]
    MDTNKVYDTIIIGGGIAGLSAALYSARQKLSTLVLSKDLGGQLTLTDLIENYPGIESIGGRGLSQKIYTQAKRFNAEFVL
    GEEVKEISQEGEIFIVNGIHNVYQSKTIVLAFGKTPRELNVPGEQEFKGKGVSY
    CAICDAAFFKGKPAMVVGEGEPGLEA
    IEILSKHANPAYYVTSSGQLSGDEELIKKIMSTSNIKIYTSSKVLQINGNGKVEEVVINKGGETLRLKVEGVIIEMGYVL
    KTDFLRGFLKLNDKGEVIVDEFGRTSREGVFAAGDVTQTPYKQAVIAAAEGVKAALSAYNYLRSKRGLGPITVDWKAEKK
    KISLKLS

    >gi|70606940|ref|YP_255810.1| methionine sulfoxide reductase A [Sulfolobus acidocaldarius DSM 639]
    MSFYYLKYIIYTMEVATLGGGCFWCTEAVFKRVKGVVSVKPGYSGGKVPNPTYEEVCTDETGHAEVVQITFDPSVITYRE
    LLEIFFEIHDPTTPNRQGNDVGSQYRSIILYHSEEQKKIAEEMIKLYERKLGKKVVTELVPFEAFYEAEDYHHDFYDKHK
    NYPYCKLVIDPKVKKFMKNFPDKASIRI

    >gi|70606977|ref|YP_255847.1| hypothetical protein Saci_1208 [Sulfolobus acidocaldarius DSM 639]
    MILKIFATDITTMIKITFFHDVICPFCYVTSKRLRKVITEFKDQVVVKHKAFAIISSLEDLKEVAFTPEEAKKLFFNEFQ
    IVKKYFPDYDPDKIIEKSKFTYVWSIPPLVACKAAEFQKGDEGHWEFYDKAQDRFFLQGEDITDEQVLISIAKELNLDLN
    KFREDIRSKKTRLSVIQDEEEAKAMGIKGVPAILINDEWLVRGVQSEEYYRDVITDLLQNKQPTKVKLKAYWEKD

    >gi|70607028|ref|YP_255898.1| methyltransferase [Sulfolobus acidocaldarius DSM 639]
    MIVYGVYNSPLGTITVAKNERGIIMLDFCDCAERNLVDNSTFTDLFHKFDNYFQGKPVEFNETVDLFVNNFRRRVFNEVR
    RIGWGKVKTYKEIAETLKTSPRAVGMALSKNPVLLIIP
    CHRIIAESGLGGFSRGIELKKKLLELEGVNIEALVRG

    >gi|70607229|ref|YP_256099.1| thioredoxin [Sulfolobus acidocaldarius DSM 639]
    MYIVNKMDENELNQLINDISRKLEEKAKNMIQTEDPTVQINDGNIDEIISKNNVVFVDCWAPWCGPCHLYEPVFKRVALK
    YKGKAVFGRLNVDDNANSADKFGVLNIPTTLIFVGGKLVDQVVGAVEEEILEEYVKKYVSN

    >gi|70607437|ref|YP_256307.1| mercuric reductase [Sulfolobus acidocaldarius DSM 639]
    MYDLAIIGYGAAGFSALIRANELGIKPVIIGYGEIGGTCVNVGCVPSKRLLSIGETYKYASIALNQKTTPNFEKSFEDKS
    EIVSSLRKEKYEDVLNSYDAKVIKGRAHFISPNAIKVNGEIVEAKKFIIATGSSPSIPDIKGLREAGYWTNVEALSPTRR
    ISSLAIIGGRALALEFSQMYKRLGVDTVILQRSNRILPNWEPEISLSVKSYLENMEEIPVFTQVKVKEVETKNDQKVIIT
    DMGEVEVDEILVATGRRPNVDLNLNVAGVSLNEKGGVKVDEELRTTNPNIFAAGDVIGEQMLESVAGKEGFIAVDNAILN
    SHKKIDKLSIPQVVFIDPNVSRVGLTQVEAESSGYTVDYRVVNMESVPKARILRESHGLIKMVVNREDMRILGAEIFGKN
    SAEIINEAALAIKFRATIYDIIDTIHVFPTMSESLKIAAIAFERDVKRMSC
    CVD

    >gi|70607552|ref|YP_256422.1| thioredoxin [Sulfolobus acidocaldarius DSM 639]
    MSWSDEDTELEMLLNRKLVNVLRSNTEKNITKFPGGKIHHLTDKNFNEFLSSFKVSVVDFWAEWCPPCHLLSPIIEELSK
    DYKGVGFGKLNVDQYPEIATSYGVISLPTVLLFHEGKPVDYVLGAVPREVIEHKLRKFIGT

    >gi|70607907|ref|YP_256777.1| sulfurtransferase [Sulfolobus acidocaldarius DSM 639]
    MTQTTTQVIVDYKWVLDHQKDPKVRIVEVDYDPSTAYNVWHIPGAVLIRWREDLRHPVVRDFIEPSQFEKLMESKGINND
    TTIVLYGDYNNWFAVYAFWLFKAYGHDDVRVLNGGRTKWAKEGLPTEQGPKEPQYPKGSYKVKKVDWGSHRAFFWELLQR
    LNKGEIGKSLVLVDVRSPKEFTGEVRAPPEYADEQTQVGGHIPGAANIPWAQAVNPETGEFKSVDELKKIYENAGITPEK
    EVITY
    CRIGERAAHTWFVLKYILGYPAVRVYDGSWAEWGNVVGSPVKKGSEP

    >gi|70607936|ref|YP_256806.1| hypothetical protein Saci_2227 [Sulfolobus acidocaldarius DSM 639]
    MVKIGEKAPIFEAVTDSGERISLADFIGKYNIVLYFYPKDDTPGCTTEACAFRDNWDSLKGFDAMVIGVSSDDTNSHKKF
    KQKYNLPFILVSDPDKKIREMYNAKGFILPARITFVIDKKGVIRHIYNSQMNPGNHVNEALKALKQIKSEEMSKS

    >gi|70607976|ref|YP_256846.1| hypothetical protein Saci_2267 [Sulfolobus acidocaldarius DSM 639]
    MVQITERRTPYYKNVKNVPPSVVRELYKKGEVTIVDIRNPWEYEDHHIPGAILIPMEYCDILLPKLETKQIVLVCEHANR
    TTWLINSKPELFEGKTVYNMLGGMELWMNMGYETTYGMDSNGMFWKDYILKKVAPSETLKK