Staphylothermus marinus F1 uid58719

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|126464943|ref|YP_001040052.1| cytochrome c biogenesis protein, transmembrane region [Staphylothermus marinus F1]
    MIKNLVLIIFLIFICLSIMLSSNIINGIERQVISRDKLSNSLTSDNYYFYVYGLHTCPHCRAMIKFLNETYGSEHLYFCD
    LNTNTTCYQKFIKLTNAGLPGYVPTVFIVYNCTVTAVLIGEYEDKSFINQFMKTNMNKTIPIYVAGQGYMGDLIIKDHMS
    FINTYLKYDGYCFMNNQAKWSTSVEVVKHYEISQLIVPLIILSLIDSVNPCTLTLYFSFIITLLATGRKVFGPSIVFILI
    IYAGYLAMGLGFKTIAQILPYKILLIIALILGIYYIIDAGRRYKREMECRLCNRLDITKRVIKNPYITAALLSLLSVTVL
    LPCTSGPLMIFASIIRDYPLYISIPALMIYNLFFITPLIIIWIITTLLNKKRAVTDFLIDKSAIIEFFSGIALILIALYY
    L

    >gi|126464954|ref|YP_001040063.1| methylated-DNA--protein-cysteine methyltransferase [Staphylothermus marinus F1]
    MLVLEPNKGFLRKADKKELYEAIYILTMLIPIGKVTTYKSIAKVLGVHPRLVGIALKKNKKPIIIPCHRVISSDGSIRGY
    SVGGKNVKKKLLEIEGVRIIGEKVDPKYIIDISEQLIS

    >gi|126464970|ref|YP_001040079.1| 1-Cys peroxiredoxin / 3-Cys thioredoxin peroxidase [Staphylothermus marinus F1]
    MPGTIPLIGEKFPEMEVVTQHGKIKLPDYFKGKYWVLFSHPADFTPVCTTEFVAFAKRYEDFKKLNTELIGLSVDSNFSH
    IKWIEWIKEKLGVEIPFPIMADPRGTVASKLGMLHAASSTHTVRAVFVIDPNGIIRAIIYYPLDNGRNIDEILRLVKAIQ
    ITDKYGRATPANWPNNELIGDSVIVPPAGTVKEAEERLKKYKCFDWWFCYEEGVVPKEEVEEVRKWLERAAKLQK

    >gi|126465005|ref|YP_001040114.1| thioredoxin domain-containing protein [Staphylothermus marinus F1]
    MISTLMGYDEELAPILEKIAHRIISRRITYTCCSKIFRGVLELNDYEELISAIKNCKVTVVNFYSTNCPYCRAYHPVFEY
    VASKYSGRAGFYRLNIDYNPEIAWRMEILGTPTTILFVNGKQINQLYGYITPEVLERHVVAALDKAKCLNKG

    >gi|126465031|ref|YP_001040140.1| alkylhydroperoxidase [Staphylothermus marinus F1]
    MMEELVNEFYTSVKKWLKTNPKQIKAFLDFLQTVREPGALDTKTKELIAVASSVAARCQWCIALHVKEAIEAGATPEEIR
    EAAWVAVLMGGGPNLAYMQLVEKAIQEFTK

    >gi|126465107|ref|YP_001040216.1| glutaredoxin-like protein [Staphylothermus marinus F1]
    MSADELFDEETKQALKQIFQQFQRKVVDYLVVEKGSESNPDPNDPDDEHEHTATHIHPHPHVHHHHGCPTCGEAEILAKA
    LMELADGKLEFKIIDKNSEEAKQLHTRYVPAFIYGSPKKNIRYYGLPSGQEFAPFIYVHLYIANNDIKLPENVIEEAKKI
    DVPLHIKIFVTPE
    CPYCPLTVDAFNQLALINDKILVETIEAIELPLEADMYNVAYVPDVIITDPDKMDEYGVEPVERING
    YMPIEEAINIVKYAAEKLKEMKKQG

    >gi|126465303|ref|YP_001040412.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Staphylothermus marinus F1]
    MVDKGEQAPNFKLYNDRGEEEELYNYKGKIIVLYFYPRAMTTGCTREAVRFNELLDEFHKHGAVVIGVSTDPVDKIAKFK
    KKHNLKFTLLSDPEGKVVKLYGVVKKGTKRLAAERTTFIIDQDMRIVEVLRNIRPAEKHADLALEIVKKLSK

    >gi|126465826|ref|YP_001040935.1| thioredoxin reductase (NADPH) [Staphylothermus marinus F1]
    MTNSVRFRLTGIIPTPSKKEEKIYDVVVVGGGPAGLTAALYAARYQLKTIVVTKLLGGLVTEAPIVDDYPGLPEIPGNEL
    VDKFVKHVRKYNVPIIIDEVINMIRKNNLWCVELRTTRRTICGYTVIYAIGSEKRKLGVPGEDRLAGRGISY
    CATCDGPL
    FKGKVVAVVGGGNSAFSSALYLASLASKVYVIHRREQFRAFPAYVERAKQDPKIEFITNTIIKEIIGDTKVRAIKLYNRA
    TGDERILEVDGVFVEIGLIPPREFFEKIGVETDEYGYAKVGPDQSTNLPGVYVAGDAAGGPCKYRFEQIITAAAEGAKAA
    DAAFKYILQNIKK

    >gi|126466010|ref|YP_001041119.1| dihydrolipoamide dehydrogenase [Staphylothermus marinus F1]
    MYDVVVVGAGVGGYPAAIYLARHGLKVAVIEEHLLGGECTNYGCVPSKALYNIAEAFRTIEKVGGNANIDWNNLSRWVSS
    VVKETRNGIEYLLESYGVDIINSKAVLKKDTAIKIGNDIISPKNIILALGTDPKPLPNVNFDGKYLLSNREVFYMEEKPE
    KILIIGGGVIGVEAAYTFSQLGIDVTIVEAMPNILPFLDKDISLTMKRFLREKNVKIYENTFVEKITIENNKVKAKLSNN
    NLIETDKILVAIGRKPKTTNIGLETVRVETTQKGFIKVNEKYQTTNPRIYAVGDVIGEPLLAHKAILESIAAARNILGEE
    SFSLSYHLVPQTIFSGLEIAWIGYTERELREKGIKYRRIRMPVSHLSAVRIKDSKYSYVKILMDENNVPYGIFVVSPLAS
    EVISSFIPFIMNKIRLEKAWRIPYPHLTVSETVREISEYILGEPIHLYLKK