Staphylothermus hellenicus DSM 12710 uid45893

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|297526629|ref|YP_003668653.1| hypothetical protein Shell_0630 [Staphylothermus hellenicus DSM 12710]
    MSANELFDEETKQALKEIFQQFQRKIVDYLVVEEGSESASDPDPDPDPIDPPDDPSEDENKQTATPIQPHPHVHHHGCPT
    CGEAKMLAKALMEVSDGKLEFKIIDKNSEEAKQLHVRYVPAFIYGSQKKNIRYYGLPSGQEFAPFIYIHSYIANNEVKLP
    ENVIEEAKKIDAPLHIKIFVTPE
    CPYCPLTVDGFNQLALINDKLLVETIEAVELPLEADMYNVAYVPDVVITDPDKMDEY
    GVEPIERINGYMPIEETINIVKYAAEKLKETKKQG

    >gi|297526695|ref|YP_003668719.1| alkylhydroperoxidase like protein, AhpD family [Staphylothermus hellenicus DSM 12710]
    MEELVNEFYASVKKWLKTNPKQIRAFLDFLQTVREPGALDTKTKELIAVASSVAARCQWCIALHVKEAIEAGASPEEIRE
    AAWVAVLMGGGPNLAYMQLVEKAIQEFTEQG

    >gi|297526749|ref|YP_003668773.1| Peroxiredoxin [Staphylothermus hellenicus DSM 12710]
    MPGTIPLIGEKFPEMEVVTQHGKIKLPDHFKGKYWVLFSHPADFTPVCTTEFVAFAKRYEDFKKLNTELIGLSVDSNYSH
    MKWIEWIKEKFGVEIPFPIIADPRGTVASKLGMLHAASATHTVRAVFIVDPNGIIRAILYYPLDNGRNMDEILRLVKAIQ
    ITDKYGRATPANWPNNELIGDSVIVPPAGTVKEAEERLKKFKCFDWWFCYEEGKVPKEEVEEVRKWLERAAKPQK

    >gi|297526764|ref|YP_003668788.1| methylated-DNA/protein-cysteine methyltransferase [Staphylothermus hellenicus DSM 12710]
    MLVLEPDKGILRKAGKKELYEAVYLLTMLIPIGKVTTYKSIAKILGIHPRTVGIVLKKNSKPIIVPCHRVISSNGSIGGY
    SWGGKNVKKKLLEIEGVRIIGEKVDPEYIIDIGEQLIS

    >gi|297527500|ref|YP_003669524.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Staphylothermus hellenicus DSM 12710]
    MTASVRFRLTGIIPTPSKKEEKTYDVVVVGGGPAGLTAALYAARYQLQAIVITKLLGGLVTEAPIVDDYPGLPEIPGNEL
    VDRFAKHVRKYNVPIIIDEVINMTRKNNLWCVELRTTRRTICGYTVIYAIGSEKRKLGVPGEDKLAGRGISY
    CATCDGPL
    FKGKVVAVVGGGNSAFSSALYLASLASKVYIIHRREQFRAFPAYIEKAKQNPKIEFITNTVIKEIIGDTKVRAVKLYNKA
    TGEEKIFEVDGVFVEIGLIPPKELFEKIGIETDEYGYAKVGPDQSTNLPGVYVAGDAAGGQCKYRFEQIITAAAEGAKAA
    DAAFKYILQNIKK