Pyrococcus horikoshii OT3 uid57753

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|14590114|ref|NP_142178.1| glutaredoxin-like protein [Pyrococcus horikoshii OT3]
    MGLISEEDKRIIKEEFFSKMVNPVKLIVFIGKEHCQYCDQLKQLVQELSELTDKLSYEIVDFDTPEGKELAEKYRIDRAP
    ATTITQDGKDFGVRYFGIPAGHEFAAFLEDIVDVSKGDTDLMQDSKEEVSKIDKDVRILIFVTPT
    CPYCPLAVRMAHKFA
    IENTKAGKGKILGDMVEAIEYPEWADQYNVMAVPKIVIQVNGEDKVQFEGAYPEKMFLEKLLSALS

    >gi|14590470|ref|NP_142538.1| NADH oxidase [Pyrococcus horikoshii OT3]
    MGENMKKKVVIIGGGAAGMSAASRVKRLKPEWDVKVFEATEWVSHAPCGIPYVVEGLSTPDKLMYYPPEVFIKKRGIDLH
    LNAEVIEVDTGYVRVRENGGEKSYEWDYLVFANGASPQVPAIEGVNLKGVFTADLPPDALAIREYMEKYKVENVVIIGGG
    YIGIEMAEAFAAQGKNVTMIVRGERVLRRSFDKEVTDILEEKLKKHVNLRLQEITMKIEGEERVEKVVTDAGEYKAELVI
    LATGIKPNIELAKQLGVRIGETGAIWTNEKMQTSVENVYAAGDVAETRHVITGRRVWVPLAPAGNKMGYVAGSNIAGKEL
    HFPGVLGTAVTKFMDVEIGKTGLTEMEALKEGYDVRTAFIKASTRPHYYPGGREIWLKGVVDNETNRLLGVQVVGSDILP
    RIDTAAAMLMAGFTTKDAFFTDLAYAPPFAPVWDPLIVLARVLKF

    >gi|14590685|ref|NP_142753.1| hypothetical protein PH0818 [Pyrococcus horikoshii OT3]
    MRFNYEQGKTYGLKPNSNMGITMERLEYQAELTWDGNVGSRAKVREFEFSIDTNTDGFNKGPNPTEYLLAALGGCLTVNW
    GRLIKKMRLNVESMKITVSGWRSRDEPQLKEIRYKVRIVTNEPEKKILRVKELAEKYGTVFNTVGKEKIKGEVEIVRPDS
    KP

    >gi|14590959|ref|NP_143034.1| hypothetical protein PH1130 [Pyrococcus horikoshii OT3]
    MKRDLALLLILVLAASFLGCISSQTQTQTSQEKWLEGLKKSEFHFYIFGLNTCPHCQRMKKLLPEYFGNSSLTFYEIRED
    KKAYNTYMKFVKTLGITGVPLIGIFYKDNLYAVVEGEIDPKVIPQLVKEAMKNNGVILIISQGQFLVPKNESKGLELIGN
    MTTWFKLNGH

    >gi|14591037|ref|NP_143112.1| peroxiredoxin [Pyrococcus horikoshii OT3]
    MVVIGEKFPEVEVKTTHGVIKLPDYFTKQGKWFILFSHPADFTPVCTTEFYGMQKRVEEFRKLGVEPIGLSVDQVFSHIK
    WIEWIKDNLSVEIDFPVIADDRGELAEKLGMIPSGATITARAVFVVDDKGIIRAIVYYPAEVGRDWDEILRLVKALKIST
    EKGVALPHKWPNNELIGDKVIVPPASTIEEKKQREEAKAKGEIECYDWWFCYKKLE

    >gi|14591219|ref|NP_143295.1| thioredoxin reductase [Pyrococcus horikoshii OT3]
    MEVKEMFSLGGGLGRSKVDESKVWDVIIIGAGPAGYTAAIYAARFGLDTIIITKDLGGNMAITDLIENYPGFPEGISGSE
    LSKKMYDQVKKYGVEVIIDEVIRIDPAECAYYEGPCNFVVKTANGKEYKAKTIIIAVGAEPRKLNVPGEKEFTGRGVSY
    C
    ATCDGPLFVGKEVIVVGGGNTALQEALYLHSIGVKVTLVHRRDKFRADKILQDRFKQAGIPAILNTVVTEIKGTNKVESV
    VLKNVKTGETVEKKVDGVFIFIGYEPKTDFVKHLGITDEYGYIPVDMYMRTKVPGIFAAGDITNVFKQIAVAVGQGAIAA
    NSAKEFIESWNGKTIE

    >gi|14591291|ref|NP_143369.1| NADH oxidase [Pyrococcus horikoshii OT3]
    MKIVVIGSGTAGSNFALFMRKLDRKAEIIVIGKEPTMQYSPCALPHVISGTIEKPEDVIVFPNEFYEKQRIKMMLGVEAK
    KIDRERKVIITDKGEVPYDKLVLATGSRAFIPPIKGVENEGVFTLKSLDDVRRIKEYISKRKPKKVVVIGAGLIGLEGAE
    AFAKIGMDVLVVELLEHLLPTMLDKDMAKIVQEEMEKHGVKFKFGVGVSEIIGNPVKEVKIGEESVEADLVLVATGVRAN
    VDLAKDAGLEVSRGIVVNEYLQTSDPDIYAIGDCAEVFDAVTGKRTLSQLGTSAVRMAKVAAENIAGKKVKFRPVFNTAI
    TELFDLEIGTFGITEERAKKEGIEVVIGKFKGSTKPEYYPGGKPITVKLIFRKEDKRLIGAQIVGGERVWGRIMTLSALA
    QKGATVEDVAYLETSYAPPISPTIDPITVAAEMAMRKFKS

    >gi|14591396|ref|NP_143475.1| hypothetical protein PH1621 [Pyrococcus horikoshii OT3]
    MPQFKDMEIRVIGKAVSSTKTLIKAGNFEIYIDKLGGEYPSPLDYTLAALAGCINIVGHMVAKEMGFEINSLEIEVNGTF
    NPAKFKGFDGDRAGFKSIEVTIRVDARVDDETLKEWIKRVEER
    CPVSDNLINETPTEITVKKA

    >gi|14591584|ref|NP_143666.1| methylated-DNA--protein-cysteine methyltransferase [Pyrococcus horikoshii OT3]
    MEIMLTYKTFKILGREILIGVVWEEKIQGIAYSLDGLEFLKDQLSRVTSHLKSRGVKVNLLEEKSRYPDLVFDVLKGKIG
    NEKGFEELSLEGLTRFEIKVYSWLVKNVKRGEVITYGKVAKALKTSPIAVGGAMKRNPYPIIVP
    CHRVVGKNNPWLYTPK
    PSYKKFLLEVEGWIS