Caldivirga maquilingensis IC 167 uid58711

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|159040636|ref|YP_001539888.1| thioredoxin [Caldivirga maquilingensis IC-167]
    MGEFMANDVDKDPELDKLLERKAREMIKNVNNTGGVVELNRSNFDEFIKTHEVAVVDFWATWCAPCFMLEPIIKRLAAEM
    PNVGFGRLNTEEEPEIAAKYYVMSLPTVIIFKNGEPIDQVIGVVPKKILQDRIKAYLND

    >gi|159040770|ref|YP_001540022.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Caldivirga maquilingensis IC-167]
    MVNVGEKAPDFELLDTDLKVRRLSDFLGKGRPVVVLTFPAAFSPVCTKELCTIRDNMSLLNKANAEVIAISVDQPWALKA
    FKEANKLNFTLLSDFNRQFIEKYGLVLEDLLGLKKLAKRAAFILDEQGVVRYKWVSDDPRNEPPYKEILNLVTAMTVSKS
    GGCG

    >gi|159040798|ref|YP_001540050.1| thioredoxin reductase [Caldivirga maquilingensis IC-167]
    MSSGGLLTSTMLNTTGLELSGEVAEKLKGKVLDTVIIGGGPAGLSAAMYAARFGLSTVVITEEIGGQVGKAGWVEDYLGY
    VRITGPDLVNKFEEHVRYYNVPILIDSVERITISNDLFKVTTVSGDEFTSRTVIIAVGERRRKLNVPGEDKYSGKGVSY
    C
    APCDAPLFKDKVVAVVGGGDSAASSALLLTEYATKVYLIHRRSSLRAQPIYQDLLLKNSKITIIWNTVVKELKGDKVLKS
    AILQRTDTGELMELPIDGIFIEIGAEPPVEFFKVIGLDLDKNGYINVNTMMETNIKGIYAAGDCVSLTPRGFRQIITAAA
    QGALAAYSAYNYILTKYGQNREK

    >gi|159040814|ref|YP_001540066.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Caldivirga maquilingensis IC-167]
    MVKEGEEAPNFELSDHNGSTIRLSDYRGRWIVLYFFPKAFTPGCTIETKEFSRLWDELEKMGVTVFGISTDSVETQRKFA
    EKYGVKFKLLSDHDKNASKAYGVLGLIGMAERVTFIINPEGKVVKVIKGVKPDEHPVKALEYLRAVIKVNK

    >gi|159040835|ref|YP_001540087.1| dihydrolipoamide dehydrogenase [Caldivirga maquilingensis IC-167]
    MPTLFMSLGKYENFPPTDAEFEDPPRASKYDVVVIGGGGGGYHGAFELSKGGYSVLLVDDKGNLGGNCLYEGCIPSKAVS
    VSLYLLEKLRGILSSVGNNDAEKVRLLWENLIDHKDNVQYLRYLQHIREIKEHGNVDFVKGIARVIDNHRVIVESIDGSW
    RREVEGRYLLVATGSLPIKIPVPGADLTLGSQELFGYRTKLRRIPSDVVVIGGGYIGVEVASVLSGLGVKTTIVEMLPRI
    LSGWDSGIVSMIEEKLRSRGVAILTNSRVTGIKEEGGQKIVEYSRPDGSVGYVTGSEVIMAVGRRANVEDLSQLGIVDRN
    HVDVNSAMATKVPNVYAAGDVIGRYMLYHAAVKESVVASWNIMMGRQIFEVNFNTIPMTIFTEPEAAMVGLSEEAAKARG
    INYTVVQYPLSDDSYAQIIGVRDGWVKLIIEKETQRIIGGVIYGEAASMMINEVALAIAVNARVKDIALLAHAHPTIFES
    IDRAAIRYSL

    >gi|159040848|ref|YP_001540100.1| glutaredoxin [Caldivirga maquilingensis IC-167]
    MEVEVFVHPTCSTCHSLIRLLKQWGFIDKVKIYDTSIDPHAALERGVRSVPSIFIDGDLVFAGVVDFKRLKSILDTGLHT
    ERVMLSDEELIERFLRGVLDSVATALWLYINVNCRAFTNDVKFLKAITNLSTYSDGNLNRLVDILKNDGNCRSIVENNKE
    RFLRVIATNFTREVYWLNGKVNGTDVLGNYNLQSIAHWAMVRGSVSRVGLVPHSLNDDEFRGKIEELWSYIKAHFDELMS
    RVASEQEELRGDSDWVLRS

    >gi|159041165|ref|YP_001540417.1| OsmC family protein [Caldivirga maquilingensis IC-167]
    MVQVVGFNGLDLDALRRIVDEISRNPSMVKQTSTWVARTRWLGGFRVKAYVRNFTVEFDEPDSLGGSGKAPKPTEYILAA
    LGA
    CLTIGFILNATKRGVRVNDLEIALEGDLNNVLVFLGLSNEGHPGYREIRVKAYINTDAPENIVKELWEYTVKTSPVG
    NTLTNTVNLITDVKVINEV

    >gi|159041166|ref|YP_001540418.1| rhodanese domain-containing protein [Caldivirga maquilingensis IC-167]
    MIRIINLNQIKDAVEDYLLLDARPYIDYMSKGHIPGAVNAQVSRIMDVITGAIKPIGELNAVFKQWGIDEDKPILIYDEY
    DGQLGARLAWTLDYCGHDKVFLVREFFSTYANSGGQLSYKLEKATHEGNFKCRPNEGVRATAEYVLSTLNSALIIDARSP
    EEFIGGNPEVPRPGHIPNAVNIPWLELLDPDGYRIVDLGLSRDKEIIVY
    CDYGLRASVVYSVLRHFNYKVRLYEKGYMEW
    GSNPNLPVVSG

    >gi|159041167|ref|YP_001540419.1| hypothetical protein Cmaq_0588 [Caldivirga maquilingensis IC-167]
    MNEEVRCLRGSASPYITDALSSPVKWWGWCSEAFEKARHEGKPILIDVGAGWCHWCHVMDEETYSDPEVAELLNNYFIPI
    KVDRDEKPDVDRRLQEIAMLISGQGGWPLTVILTPNGDPLYAATYLPPRDKAGLPGMVKVLNATLNALRFKSSEVAEAVR
    QVREALSQEESATPSEPSWDSLESVINDIVSLHDDEYGGFGTMPKFPQPTFHTLLLHMGYHGDEHLVKLVTYTLRRMYYG
    GVYDQLGGGFHRYSVDREWLIPHFEKLLIDNAELLANYAEAYAVTGDVDLRNAAMGITSYLTSELWNPEGGFYASQDADV
    DPSDEGGYYRWSIDELRSLLSNEEFELIYRYLGVYRFKDSGEKAVLHVAMSLTEAARLAGIEPNRAEEVLRSAISKLRQA
    RSKRPKPRIDRTVYTNWSSAAALALMEYHDYVNPGTLSYAVKTVDYIMSKLYINGELRRGFRSGPLYMGSLDDYAYTLIA
    SIQAFSHTGEVKYLSFARELAEGLINNFEAKDGGFYDTKLSNDSPIGMRVKPIFDTPNWSPNALAIMGLQDMARLGLIKG
    DSLDKAVKSLYPLATRYGRSAASYFITLWRYLAEPPKVIIIGDSRDDEAFLSLWKIALSTFRPGKLVIPLTRDYVNEFTG
    DQTISYMVREQRRLSRPLAFVCAYTACSMPIEKPESLRQVIETFMVNRYMNR

    >gi|159041170|ref|YP_001540422.1| rhodanese domain-containing protein [Caldivirga maquilingensis IC-167]
    MSYAHPEVLVDTEWMRKHLNDPKVRVVEVDYDPNTAYFAWHLPGAALLTWKDHIRHPVRRDFVEPDQFAKYMEERGISND
    TTVILYGDYNNWFAAYAFWLFKVYGHEDVRLLNGGRTKWAKENGPTCSGHQEPHYYKDVGARYTVKKVDWGGHRVYLWEI
    LNRLNKGEIGKSLALVDVRSPREYTGEITAPPEYPNEHAQVGGHIPGAINIPWSLAVNPDTGEFKPVEELRRLYSQYGIT
    PDKEVITY
    CRIAERASHTWFVLKYLLGYPAVRVYDGSWAEWGNAVGAPVKKGNEP

    >gi|159041353|ref|YP_001540605.1| putative peroxiredoxin [Caldivirga maquilingensis IC-167]
    MSVEFRMPLIGEKFPEIEVATTHGKIKLPDYYKGKWFVLFSHPGDFTPVCTTEFVSFAKRYEDFRKINTELIGLSVDTDI
    SHIEWVTWIEKTLGVKIPFPIIADPMGNVSRRLGMIHAESSTSTVRAVFIVDDKATVRLIMYYPLELGRNIPEILRAVKT
    LQLIDKYGTVAPANWPYNEIIGENMLNPPPHHVEEAPKRLQQYKGYAWWLTYREIPKEEVEDTKRTIKIRIE

    >gi|159041385|ref|YP_001540637.1| protein of unknown function DUF395 YeeE/YedE [Caldivirga maquilingensis IC-167]
    MQLETLYEKDRRTVWIASWILLALALGLLLGGVYMQVVLHETKAPLLLGIVAALPLAIPLELWNFSDPDTLFRVMALQDR
    FLVACFGFAIGLGAILLYGLNLFTHPNFGIKDLFIGGIILGGLLFGVGVGLAGYFPGTIWIALGQGRRDALYAVAGGLLG
    AFTWSMIFGWARGPLWDTLNFGPITWPNLFGIPFSDKVGMFAGSIVFGVLLLLVFLFLPRYPKQPIKHACGFHLAGVGKE
    TVIRFSDMMNDDLVKYPNQNRFLVELINESSVRNARFIMVLGAAFTIEAVAVIILHQIFGESTTYSWIGAQLSYLVNPYW
    AASNPYFQLFGGMHIVNGIPVNKPFSEIGWEPITDLSTFIGGLVSSLFISRRFMGFRNQIPRVWAHRFGESTWKRFLGSF
    FGAYLVLFGARMANG
    CASGHILSGDIQMAVSSALFLVMVMIGSMLTLRYVLKLRINAWGYVQ

    >gi|159041635|ref|YP_001540887.1| methylated-DNA--protein-cysteine methyltransferase [Caldivirga maquilingensis IC-167]
    MKNSDQLWRLGKSDLGLLVHRDFKGLVDKTTIIRISSFLRKFSNINITDYVEPDPLTVVRMAKIPNDNLGLVMLAILAIP
    RGFVASYSDLAELLNMTPRLIGLFASKNPMPVLIP
    CHRVINRDGTIGGYSAWHRDGKGIKAMLLSMENVRVNGIKVSKDN
    FVDSSELKDNFYRIYNYYHSLMSEYSSSEQSE

    >gi|159041689|ref|YP_001540941.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Caldivirga maquilingensis IC-167]
    MTRKVVIIGAGAAGASAAARARRLDPEAEVTLIDKGPLISHAPCGIPYYIGGVVKDAGELAVYSPEEFARERRINVRVNA
    EAIDVDSSNRIVLVKEGNSVVKYEWDVLILATGAKPIVPSIEGNDLRGVLTLRLPHEAGRLREEALRADKVAVIGGGYIG
    LELAEALRALGKRVMLFEMMPHVLPSTLDEDLAKLIHDELIKNNVELHLSEKVVGFRGVNGEVKSVITDKGEYNVDKVFM
    GVGVRPDVDLALKAGVKLGETGAVYVNEYMETSVPGIYAAGDVAETWSMVTGRRMYVALAPPANKMGQVAGANAVKGRFL
    KFPGVLGTAITKVFNLYVARTGLTERQAREWGFKPYSATVKVKTTAHYYPGGGVATIRLTADEDTGRVIGAQVIGNDRLI
    AGYIDTAAALIGKGATVDDFFFADLSYSPPTAPVWHGLIVAARVLSRGKY

    >gi|159041720|ref|YP_001540972.1| periplasmic binding protein [Caldivirga maquilingensis IC-167]
    MDYRLTALAVIVVLLAAAVGYLAYRVNQPVKPVTITLPVTSTVTVTSTSVATVVTTTSATLTTTATSTLTTTAVTTVTAT
    VTPVQNMRIASLDPACSQIIFTLGLGNKVVLIDTYSEQLLSYFNVTIPSNATVLTSIWPTPSIEAVVNASPTVV
    CYDLGF
    YGTSTLASFSSIGLPLVIINGTADRTFQQIEMDVYSTAKALGVPERGLAVASWMNNIINGVRSRVTGLSEPTVVFMGWNN
    PIYAPSNLTFIGYEITIAGGLDVVNTTVPWPTITPSQLIVYNPDYIIASNFMGNCTATLEAIMQVPGINYTKAVKEGHVY
    VLGNLATSLVEEPGPLSVYGAEVIAAILHPEAFGLSNVPQCVSGEWVISNLKPTLPSQGG

    >gi|159041816|ref|YP_001541068.1| heavy metal translocating P-type ATPase [Caldivirga maquilingensis IC-167]
    MNEASRINVKLSFREGVRRTAFKIVGMHCATCSLTVQKALLSVPGVLAADVSLANDEAVVVLDPGRVKYIDLLKAVEKAG
    YDIYREEATVGIRGLSPGDEALILNALNIPGVFEARVNLAYGEVKVTYNPLELNESNIVKAIEDLGLKVTYVKTGASGFD
    VDKRASEADLRDLRNRLLVSAPLTAVIMIIVWVLEPKGVIPSQSALWVGLALATIVEFYPGWRFIRGAVRAFRNGTANMD
    TLVALGTLTAYTYSLLYALHLVGGEAFLDSGPAVITLILLGRWLEARVRLRAASTVRSLAQLIPGKARVLVDGREIETNV
    KDIKPGDTIIIRPGELIPVDGIVNEGNGHVDESSMTGESEPRLKRIGDVALAGTRLLDGYLVIRATRVGEFSLMAQVIKL
    AREAQAARLPIQSIVDKISAYFTWVVIAVAALTLITWLSLGAPLYLAVLHMASVLVVACPCALGLATPMSIVVGVNKAAQ
    DGILIKRGEAFERLNGVKVMAFDKTGTLTEGAPRVIKTIIDKESLILAASAEYPSNHPLAKAIVNYAESMGVKPITVSEF
    NQLEGMGVIAVVNGRSVGVGNMKLVKGMEAYLSPEFRKLSEGIESEGYTPLFVVIDGVVKGVLAVGDPLRVNAYETVNEV
    KRLGLRTIMLTGDAEGPAHAVAEKLGIDDVYADLMPDDKARVIREVKTKYGSVAMVGDGINDAVALNEADVGIAMGTGSD
    VAKEAGDVVLVSGNLKAIPRLIRLSRTVVSNIKFNIFYAFAYNIILIPVAAGVIPGLTLRPELAGLAMALSSLTVTLNAY
    SIKLRT

    >gi|159041886|ref|YP_001541138.1| hypothetical protein Cmaq_1322 [Caldivirga maquilingensis IC-167]
    MSEGKGRIIFFTTIPPSEEDRIQAMLRIALIASSLGYEVIIYLALHSVMIVKRSVFEKLSDNIRSMITDAVKRNVKIMAC
    KVAMEGFNVKEGDLISGVITAEPRDLFEYARNAITVSW

    >gi|159041907|ref|YP_001541159.1| glutaredoxin-like domain-containing protein [Caldivirga maquilingensis IC-167]
    MSATPLAPPTGPEEVHIEVDEETKGIIREMLSQMVNPVTFDLFTTGNCAGRDTNWCTPTEELLDLLSSLAPEGKLIVNKH
    RLDQNKDDGAKFNVEENRVPVIYINGGIIRYFGAPLGEEVRAFIETITRISTGKTGLRARTKSTLASMINSDAKTVEVVT
    VVTPS
    CPYCPYAVLLANMFAYESKGKVRSVVVEAYEEPDIADMYGVTAVPTVVIRNEGSTGDVEFVGVPPEADLLKKVLS
    YSGFNPPGQ

    >gi|159042066|ref|YP_001541318.1| mercuric reductase [Caldivirga maquilingensis IC-167]
    MAKELVIIGYGAAGFAALIRANELGIKPTLIGYGPLGGTCVNVGCVPSKTVLRIGELYGYAKGFEPSLNWDYMSAFKHEL
    DIVNKLRKLKYEDVLAKYDVELIEGRAYFTSPNSVKVNGRVIEGERFIVATGSSPNIPNIKGLREVGYWTNVEALNPQRR
    IGSLIVLGGRAQALEFAQMYRMLGVDVAVVQRSQVLIPDWEPEISLGIRQVLEQSGVVVLTGTRVLEVKQGVEGKVVVTD
    KGELEADEILVAMGRRPNVDLNLNEAGIKLSEKGGILVDDELRTTNPRVYAAGDVLGGPMLEALAGKQGVVAVDNAVLNA
    HRRIDMLAVPQAIFTKPNLARVGLTVAEAVAMGIDVDYRVVFMDNVAKAHILGDTNGLVKMIIEKGSGRIIGVHAMGENA
    AEFINEAALAIRLKATINDLIDTIHVFPTMAESLKLAAQAFYRDITKMSCCVD

    >gi|159042069|ref|YP_001541321.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Caldivirga maquilingensis IC-167]
    MRTRTVILVIASIVVLSTVVYLFTRPTRTTGVSVGYYAPDSSFELINGTSVKLYDFLNHGHYVLVYFVSTWCSDCAIGLI
    MLSHRLEPILQSHNVIVLVLENYNDLGYQGEPVNEFVSYFAGNSSKYFTVGIASLKMTETYNPEGYPEIYYLIAPNGKII
    YENTDLAGTYNSLISIVNGLGNS

    >gi|159042165|ref|YP_001541417.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Caldivirga maquilingensis IC-167]
    MNHFYKPHVILMVMRVVVIGGGAAGMSAASRIKRIRPDYDVVVFESTNIVSHAPCGIPYFLEGLFNDESLFMHYTPDYFT
    SVRGVRVRVNESVVKVGDGFIITNTGNRVNWDYLVLATGSVPRIPNIPISGNKVFTIHHPSRAVEVRRILDSVNVIGIVG
    SGYIGLEVAEAMRVKGKEVIIVSRSSYPLSRSLDSDLGALVTEELIKSGVKVKLNERLIEIGRQGDSQVIITDSGKYIVD
    AVILATGIAPNVELASMLNLRIGETGAVWVNEHMATSRENVYAAGDVAETINVVTNEPYWHPFGTTANKMGYTAGSNIAG
    LRLRFPGVAGTSMTRFMNMYVASTGLTESEAVKHGLRVASTVIRARTRARYYPGDGELIVKLIAEKGSGRIIGGQFIGSD
    GGQVLGRVNTLASLIYKKATVEDLFLTDLAYLPPVTQVWDPLIIAARQLFNKL

    >gi|159042422|ref|YP_001541674.1| UBA/THIF-type NAD/FAD binding protein [Caldivirga maquilingensis IC-167]
    MISSDRYIRQLPLLGIEGQRRLSNSSALVVGLGGLGSLASMYLAGAGVGRLILVDFDTVSISDLHRQLLYTTRDIGKSKV
    EVAERRLREINPEVKIEAHQTVLTKNEEAEELVASVDVIVLAVDNMKTRVDVDELAAKYSKPIVNGGVDGWFGLVTTVVP
    GKTPRLAEILNIRGLNPVS
    CVEGLCNAVIGPTVGVVASWQALDALRILAGLEPTLAGKLLVIDSSKGMIEIIPISSP

    >gi|159040642|ref|YP_001539894.1| hypothetical protein Cmaq_0050 [Caldivirga maquilingensis IC-167]
    MNSKVIIIVAVVVAVVAVVLVTSILGIIPLRIPGLSIGKSLPSNGFVYVIGAYPNVPTLVRDVVYGYGLSGLGSGEGVGS
    LTPNAVQYVLRLVEGGNDYVITYGNPKAPVWLIEFLDPV
    CPYCAIFDVYNFSQITPLIESGRVYYIAVYFPTHALGYYQA
    YQQQPNATVLLQAFNDSVALWLQWKCISSVNATQTLSAINETYIADFMYGLVPYVEYNNQAYLIYYPIFSYRLLNSTYYP
    ECKVTLNPTQAVNMTSSAWSQVNNIASLLIPKNLQGSIGTPMFIIMKNPNN