Pyrococcus furiosus DSM 3638 uid57873

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|18976466|ref|NP_577823.1| glutaredoxin-like protein [Pyrococcus furiosus DSM 3638]
    MGLISDADKKVIKEEFFSKMVNPVKLIVFVRKDHCQYCDQLKQLVQELSELTDKLSYEIVDFDTPEGKELAKRYRIDRAP
    ATTITQDGKDFGVRYFGLPAGHEFAAFLEDIVDVSREETNLMDETKQAIRNIDQDVRILVFVTPT
    CPYCPLAVRMAHKFA
    IENTKAGKGKILGDMVEAIEYPEWADQYNVMAVPKIVIQVNGEDRVEFEGAYPEKMFLEKLLSALS

    >gi|18977062|ref|NP_578419.1| hypothetical protein PF0690 [Pyrococcus furiosus DSM 3638]
    MKKAGIIEEKPKGSKVVIEVITSPGCPYCPIAWTMAQEIARKYDGVVAKEVSVATSEGQRKAMEHRIMGTPSSPAIPTVN
    ILSL

    >gi|18977094|ref|NP_578451.1| alkyl hydroperoxide reductase subunit c [Pyrococcus furiosus DSM 3638]
    MIRVGEVVPDFEADAYFPEKDEIGKLRISDYRGKWVVLAFYPADFTFVCPTELEELAEYYEEFKKEGAEIISVSTDTAYV
    HKAWHDTSPAIKKVRFPMLADPAGKICRLFGTYIEDEGISWRATFIIDPDGKVVHMEMHDNSIGRSAKEILRRLRAAKFV
    RENPGVVCPASWEPGKEALKVSLDLVGKI

    >gi|18977096|ref|NP_578453.1| hypothetical protein PF0724 [Pyrococcus furiosus DSM 3638]
    MKLKALFLLLALGSLIVPRIEAEEFESSKVHFYMYGAYWCPHCRNVKESIKEHFGEETLTYYEIEGVEHNKNKFEELYLL
    TGISGIPATAIFYEGEIYAVIEGEFDVSKTWQIITEAKNQGGVILVTSGKAYILKWDSQEVQKLKEIFLSGKVNETQKKA
    EEKSICGPASVLLLSMGAIYLRKRNYSTEVSSNV

    >gi|18977112|ref|NP_578469.1| heavy-metal transporting cpx-type atpase [Pyrococcus furiosus DSM 3638]
    MKITLKVNGMTCAMCVKTIEMALTELEGVKVAKANLNNETVFVDFDESKVSLNQIIKAIEDVGYEVIRERRDAVIKIGGM
    T
    CAMCVKTIENAIKELPGVMEVSVNLATESARVSYNPSILTIEDIKKAIESVGYEFLGVEGEESHDIEKEVREKHIREMK
    RNLLVAWSVGIPLFISMQLKRFGFHIENLIYVQFLLATIAIAYAGRGIFKKAYSSLRHKTLNMEVMYSLGIGSAYLTSVL
    ATFGIIPREFNFYEASVLLMAFLLLGRYLEAKAKGRTSEAIKKLIGLQAKRATIVRDGKEIEVPISEVKVGDIVIVKPGE
    RIPVDGVVIEGESYVDESMLTGEPIPNLKKKGDKVIGGTINKNSVLKIKAEKVGRDTLLAQIIKLVEEAQNTKPPVQRFA
    DTVVTYFIPTVLAVSLLSFAYWYFIADKPLVFAFTTLLSVLVIACPCAFGLATPTALTVGIGKGAELGILIKNGEALEIA
    KNATVVLFDKTGTLTKGKPEVTDVISLDIDEKELLSLAASAEKRSEHPLGEAIVRKAEELGIEIEEPEKFKVLPGRGVEA
    RVRGKEVVVGNKKLIAEKGISLEGVKNIIHRLENEAKTVVIVVVDGKIVGIIGIADTLKEGAREAIEELHRMGKKVGIIT
    GDNKRTAEAIGKILGVDYILAEVLPGDKANEVRKLQEKGEIVIFVGDGINDAPALAQADVGIAVGNATDIAMESGDIVLI
    RNDPRDVVRAIRLSQKTLSKIKQNIFWAMFYNTLLIPFAAGLSYKIFGVTFQPEWAAGAMSLSSVSVVTNSLLLKRVRI

    >gi|18977113|ref|NP_578470.1| hypothetical protein PF0741 [Pyrococcus furiosus DSM 3638]
    MIIEYDGEIDFTKGRVVLWFSIPGCPPCRLVERFMTELSEYFEDIQIVHINAGKWKNIVDKFNILNVPTLVYLKDGREVG
    RQNLIRSKEEILKKLKELQE

    >gi|18977124|ref|NP_578481.1| thioredoxin peroxidase [Pyrococcus furiosus DSM 3638]
    MKIGDKAPDFVLKDQHGKEFKLSDFRGKKILLSFHPLAWTKICEKQMKALEENYEKFESLNVIPVGISVDPIPSKKAWAE
    HMGLKKLRILSDFWPHGEVAKLYGVFREKDGFSERANILIDEEMKIIFYKVYPIRELPDLNEIFDILKI

    >gi|18977405|ref|NP_578762.1| peroxiredoxin [Pyrococcus furiosus DSM 3638]
    MIVIGEKFPEVEVKTTHGVIKLPDHFTKQGKWFMLFSHPADFTPVCTTEFYGLQIRLEKFRELGVEPIGLSVDQVFSHLK
    WMEWIKEKLGVEIEFPVIADDRGDLAEKLGMIPSGSTITARAVFIVDDKGIIRAIVYYPAEVGRDWDEILRLVKALKIST
    EKGVALPHKWPNNELIGDKVIVPPASSVEQIKEREEAKAKGEIECYDWWFCYKKLE

    >gi|18977558|ref|NP_578915.1| NADH oxidase [Pyrococcus furiosus DSM 3638]
    MEKKKVVIIGGGAAGMSAASRVKRLRPEWDVKVFEATEWVSHAPCGIPYVVEGIAPKEKLMHYPPEVFIKKRGIDLHLKA
    EVIEVETGYVRVRENGEEKSYEWDYLVFANGASPQIPEIEGVDLPGVFTADLPPDAVAITEYMEKNKVEDVVIIGTGYIA
    LEMAEAFVTRGKNVTLIGRSERVLRKTFDKEITDIVEEKLRQHLNLRLHEKTLSIEGRERVEKVITDGGEYKADLVIIAT
    GIKPNVELAKQLGVKIGETGAIWTNEKMQTSVENVYAAGDVAETKHVITGKRVWIPLAPAGNKMGYVAGSNIAGKEIEFP
    GVLGTSITKFMDLEIGKTGLTENEAVKEGYDVRTAFIKANTKPHYYPGGREIWLKGVVDNETNRLLGVQAVGAEILPRID
    SAAAMITAGFTTKDVFFTDLAYAPPFAPVWDPLIVLARVLKF

    >gi|18977661|ref|NP_579018.1| molybdopterin biosynthesis protein moeb [Pyrococcus furiosus DSM 3638]
    MRIDFSRHFPIIGIEGQRKLQEKKVAVVGAGALGSWEVYFLKKLGVGEIIVVDRDFVEASDIPRTIYTEKDIGRPKVDVL
    RDRFGVKGYFEDLNPGTLYLLDEADLILDGTDNIYTRQVINDYAIKTGKPWIYVGVLATYGNIMPIIPEKTACFRCIMPK
    LPSRPLPT
    CATAGIMSYVPPLAAAIAVSLATKILLGEEVKSELIFFDTKTLEFEKIEIPRRDDCPACVRKELTFLEKQIK
    IERMCDGSIQVVPPERLEVDLEDLAKRLEEMGIEYILTSQFIQFEDEDYEVLIFKGGRMIIRGAEDEKTAKNIFARYLGG


    >gi|18977794|ref|NP_579151.1| thioredoxin reductase [Pyrococcus furiosus DSM 3638]
    MFYGITHKCSKMLLSRHHQVRAGGEDMFSLGGLTKSSVDTSKVWDVIIIGAGPAGYTAAIYAARFGLDTLIITKDLGGNM
    ALTDLIENYPGFPEGISGAELSKRMYEQVRKYGVDVIFDEVVRIDPAECAYYEGPCKFTIKTANGMEYKSRTVIIAVGAE
    PRKLNVPGEKEFTGRGVSY
    CATCDGPLFVGKEVIVVGGGNTALQEALYLHSIGVKVTLVHRRDKFRADKILQDRFREAGI
    PAILNTVVTEIRGKDKVESVVLKNVKTGETFEKKVDGVFIFIGYEPKTDFVKHLGITDEYGYIKVDMYMRTKVPGIFAAG
    DITNVFKQIAVAVGQGAIAANSAKEFLENWNKKDVE

    >gi|18977829|ref|NP_579186.1| glutaredoxin/thioredoxin-like protein [Pyrococcus furiosus DSM 3638]
    MIRRKKMLELMKRMGIIEERKPKKKVIIEVITAPGCPYCPIAVQMAREIEKKYPGVIVRELSVATPEGRRKAMEHNILGT
    PTILINNRVEFIGVPRFIDFERRVRELLS

    >gi|18977853|ref|NP_579210.1| hypothetical protein PF1481 [Pyrococcus furiosus DSM 3638]
    MVEYKDMTIKVVGERLSPTKMKVKAGDFEIMMDKVNGEAPSPIDYVLAALAGCINIVATLVAKDMGINIEDLTVEVEGVF
    NPGKLYGKGNERAGYKEIKVKIKVKSDADEETLKKWLEQVEAR
    CPVSDNLANPTPLNIEVERY

    >gi|18977904|ref|NP_579261.1| NADH oxidase [Pyrococcus furiosus DSM 3638]
    MRIVVIGSGTAGSNFALFMRKLDRKAEITVIGKEETMQYSPCALPHVISGVIEKPEDVIVFPNEFYEKQRIKLLLNTEAK
    KIDRERKVVVTDKGEIPYDKLVIATGSKAFVPPIKGVENEGVFTLKSLEDVRKIKEFIKKRNPKNAVVIGAGLIGLEGAE
    AFAKLGMKVTVVELLEHLLPTMLDKDIAKIVEENMRKYGVDFKFGVGVDEIIGDPVEKVKVGEEEIDADIVLVATGVRAN
    VELAKEAGLEVNRGIVVNEYLQTSDPDIYAIGDCAEVIDAVTGKRTLSQLGTSAVRMAKVAAENIAGRNVKFRPVFNTAI
    TEIFDLEIGAFGITEERAKKEEIEVVVGKFRGSTKPEYYPGGKPIVVKLIFRKEDRRLIGAQIVGGERVWGRIMTLSALA
    QKGATVEDVVYLETAYAPPISPTIDPITIAAEMAMRKL

    >gi|18978250|ref|NP_579607.1| methylated-DNA--protein-cysteine methyltransferase [Pyrococcus furiosus DSM 3638]
    MILEVRKFQVKNKAVYIGTLSEDKIFGIIFSIDEPEVIRHRIPTLINFLEKRLNKKLEIKEGNSGFSDVVFKTLIGKISN
    EEAAEFIEVSYLTKFERKLYIYLVENVKRGEVITYGELAKILNTSSRAVGAAVKRNPYPIIVP
    CHRVIGRKNPYLYTPKP
    EYKKFLLEVEGWTS

    >gi|18978378|ref|NP_579735.1| NADH oxidase [Pyrococcus furiosus DSM 3638]
    MLESYDVVVIGGGPAGMGAAIKAKELGLKVLLLDDNDFLGGILPQCIHPGFGLHYFKEELTGPEFAYRLINKLDGVEVKT
    SARVIEIQNYSDLEKFVTYVSPEGVKKVATKTIIYAAGARERHAFEIGIVGDRVAGIYTAGEAQALMDLYGILPGRDIVI
    VGSGDVGLIMARRFALEGCNVKAVIELMPYPGGLARNLMILKDFNIPLYLSHKVVEVRGRKRVEKVKVVKVDENLREIPG
    SEFWIEADTLIISAGLIPNVKLLQEIGVRIDPATGGPVVNDRLETSVPGIFVAGNSLLINDLVDYVVEQGETAAEGAKEF
    IENGGIKSTRWIKLVKGENVRLVAPHYLSGERDVWIYARVQRPIEDVTLEFPEIGKKLRLPVVKPSEMLRIKLRGEEIRK
    AKEKITMQVVKNE