Pyrococcus abyssi

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|14520379|ref|NP_125854.1| glutaredoxin-like protein [Pyrococcus abyssi GE5]
    MGLISEEDKRIIKEEFFSKMVNPVKLIVFIGKEHCQYCDQLKQLVQELSELTDKLSYEIVDFDTPEGKELAEKYRIDRAP
    ATTITQDGKDFGVRYFGIPAGHEFAAFLEDIVDVSRAETDLMAESKEEVAKIDKNVRILVFVTPT
    CPYCPLAVRMAHKFA
    IENTKAGKGKILGDMVEAIEYPEWADQYNVMAVPKIVIQVDGEDKVQFEGAYPEKMFLEKLLAALS

    >gi|14520488|ref|NP_125963.1| monooxygenase [Pyrococcus abyssi GE5]
    MYDVAVIGGGPAGMAAAIKARELGLSVILIDENDYLGGILPQCIHPGFGIHYFKEELTGPEFAYKLMNRLRDVEVRTSAR
    VVEIINYSDIEKRLKVISPSGIEEIRAKTIIYAAGARERHAFEIGITGDRVAGIFTAGEAQTLMDIYGIMPGREILIVGS
    GDVGLIMARRFALEGARVKAVIELMPYPGGLARNVMILNDFNIPLYLSHKVVEIRGKGRVQRVKIVKVDENLREIPGTEF
    WVDVDTVIISAGLIPNVKLLTKVGVAIDPSTGGPIVNDRLETTVPGIFVAGNALVINDLVDYVVEQGELAAEGAKEFIDN
    DGIRSRKWTRLIKGENVRFVVPHYLSGDRDVWIYLRVSRPMEDVRLEMPEIGKRMRLPIVKPSEMIRIKLRGKDVKGVDK
    ITVRVVK

    >gi|14520606|ref|NP_126081.1| methylated-DNA--protein-cysteine methyltransferase [Pyrococcus abyssi GE5]
    MLSCESFKIKGREIIICVIWEEGIQGIVYSLDGREFLEKQLSRLISMLNKRGVSLSLKERHSKYPELVFNVLTGKISNEE
    GFEELSLEGLTDFEIRVYSWLVKNVKRGEVITYGKVAKELKTSALAIGGAMKRNPYPIVVP
    CHRVVGKKDPWLYTPKPEY
    KKFLLEVEGWTS

    >gi|14520760|ref|NP_126235.1| hypothetical protein PAB2001 [Pyrococcus abyssi GE5]
    MAKYKDLEIRVVGKAVSPTKTLVKTENFEIMVDKLGGEHPCPLDYTLAALAGCLNIVGHMVAKDMGFNIEELEIEVTGIF
    NPAKFMGLDGERAGFKSVKAIIRVKADVDEEKLKEWLKKVEERCPVSDNLTNLTPTEVIVEKK

    >gi|14520867|ref|NP_126342.1| NADH oxidase (noxA-2) [Pyrococcus abyssi GE5]
    MRVVVIGSGTAGSNFALFLRKLDRKAEIIVIGKEPTMQYSPCALPHVISGTIEKPEDVIVFPNEFYEKQKIKMMLGVEAK
    KIDRERKVVITDKGEVPYDKLVLATGSKAFIPPIKGVENEGVFTLKSLDDVRRIKEYIGKRNPKKAVVIGAGLIGLEGAE
    AFAKLGMEVLVVELLEHLLPTMLDKDMASIVQKNMEEHGVKFRFGVGVSEIIGNPVEAVKIGDETVEADLVLVATGVRAN
    VDLAKDAGLEVNRGIVVNEYLQTSDPDIYAIGDCAEVIDAVTGKRTLSQLGTSAVRMAKVAAEHIAGKDVKFRPVFNTAI
    TELFDLEIGTFGMTEERAKREGIDVVVGKFRGSTKPEYYPGGKPITVKLIFRKEEGRLIGAQIVGGERVWGRIMTLSALA
    QMGAKVEDIAYLETAYAPPISPTIDPITVAADMALRKMKR

    >gi|14520939|ref|NP_126414.1| thioredoxin reductase [Pyrococcus abyssi GE5]
    MLLNIHQESYVEVVKMFSLGGLGKSRVDESKVWDVIIIGAGPAGYTAAIYAARFGLDTIIITKDLGGNMAITDLIENYPG
    FPEGISGSELAKRMYEHVKKYGVDVIFDEVVRIDPAECAYYEGPCQFEVKTANGKEYKGKTIIIAVGAEPRKLHVPGEKE
    FTGRGVSY
    CATCDGPLFVGKEVIVVGGGNTALQEALYLHSIGVKVTLVHRRDKFRADKILQDRLKQAGIPTILNTVVTEI
    RGTNKVESVVLKNVKTGETFEKKVDGVFIFIGYEPKTDFVKHLGITDEYGYIKVDMYMRTKVPGIFAAGDITNVFKQIAV
    AVGQGAIAANSAKEFIESWNGKSIE

    >gi|14521140|ref|NP_126615.1| cation-transporting ATPase, P-type [Pyrococcus abyssi GE5]
    MMPRKLKLEGLDCASCAYEIEEALRKEGFKFAVVNFATKEAIIEGDIEKAKEVIKKVEPDVEVVEEVHIHDHAHGEFEKR
    TIYFIGISLVLFTIGILMRYYYAIDNTLVFGLFLASYLISGWKVLKSAIVNSLNGNVFDENFLIAVATIGAFLIKEYPEG
    VAVMLFYVIGEFLQDMAVDKSRRSIKALLALKAEYANLVRDGTVVKVKPEELKVGDIIIVKPGEKVPVDGVIIEGTSSVD
    TSALTGESMPRTVKEGDEILSGMINLTGLLKVRVTRELSESTVSRILELVENASARKAKTEKFITRFAHYYTPAVVGIAT
    LIATVPPLVFKESFTSWVYRALVILVISCPCALVLSIPLGYFGGIGRAAKEGILIKGSNYLDALKDASIVAFDKTGTLTK
    GVFKVTKIETRNGFTEEEILRFAALAEAHSNHPIAKAIREAYGKEINEAEITEYEEIAGHGVRARIDSVEVMVGNDKLLH
    RSNIEHDTCKVKGTIAHVVIDGQYAGYIVISDEIKEDAHLAVKELKRLGVRKVVMVTGDSRDVAEEIAKQLGLDGFYAEL
    LPEDKVKIIEKLEKEKGNGKLVFVGDGINDAPVLARADVGVAMGALGSDAAIETADVVIMDDKPSKLPKAIQIARKTQRI
    VWENIIFALGVKLAFIGLGIFGKATMWEAVFADVGVALIAVFNAMRVLR

    >gi|14521246|ref|NP_126721.1| peroxiredoxin [Pyrococcus abyssi GE5]
    MVVIGEKFPEVEVKTTHGVIKLPDHFTKQGKWFILFSHPADFTPVCTTEFYGMQKRLEEFRKLGVEPIGLSVDQVFAHIK
    WMEWIKENLGVEIEFPIIADDRGELAEKLGMIPSGATITARAVFIVDDKGIIRAIVYYPAEVGRDWDEILRLVKALKIST
    ENGVALPHKWPNNELIGDKVIIPPASTVEEKKQREEAKAKGEIECYDWWFCYKKLK

    >gi|14521289|ref|NP_126764.1| hypothetical protein PAB1651 [Pyrococcus abyssi GE5]
    MKKVAFILIIVLLAFSLGCLSSTSTPTTTQTSQPSPTTPSKTQAQDWLEGLDKSKFHFYVFGVNTCPHCRRMKELLPEYF
    GNKSLTFYEVRENKTAYEFYLKFMETLGVTGVPLIGIFYENKLYAVVEGEIDPRDIPKLVKAAMKENGVALIISRGQFLI
    PRNETKGIEAISNLTSWFKLGEH

    >gi|14521611|ref|NP_127087.1| NADH oxidase (noxA-1) [Pyrococcus abyssi GE5]
    MRVVKVKKTVVIIGGGAAGMSAASRVKRLKPEWDVKVFEATEWVSHAPCGIPYVVEGISPTEKLMHYPPEVFIKKRGIDL
    HLNAEVIEVDTGYVRVREKDGEKSYEWDYLVFANGASPQVPAIEGVDLKGVFTADLPPDAVAIREYMEKNRVEDVVIVGG
    GYIGLEMAEAFVAQGKRVTMIVRGERILRRSFDKEVTDIIEEKLKQHVNLRLQEIVLRIEGKDRVEKVVTDAGEYRADLV
    ILATGIKPNIELARQLGVRIGETGAIWTNEKMQTSVENVYAAGDVAETKHVITGRRVWVPLAPPGNKMGYVAGSNIAGKE
    IHFPGVLGTTVTKFLDVEIGKTGLTETEALKEGYDIRTAFIKASTRPHYYPGGKEIWLKGVVDNETNRLLGVQAVGAEIL
    PRIDAAAAMLMANFTTKDAFFTDLAYAPPFAPVWDPLVVLARVLKF