Pyrobaculum islandicum DSM 4184 uid58635

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|119871684|ref|YP_929691.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Pyrobaculum islandicum DSM 4184]
    MPEVKGPYLGMKIPEDLCFDTDAGRRCFRDYKGRWLLLFSHPGDFRPVCTTEFIAFAKKYEEFKKRGVELLGLSVDTVYS
    HVEWKRQIKQLWGVEIPFPIISDVPDFQVANLFNSIPPGTTATVRMVALIDPELKLVWFALYPLAVGRGVDEILRVIDAI
    QFNYKHGYLAPVDWRPGDPVIVPPPQRYEGAEKRLKETGIECKTWWFCTKKYEEVVG

    >gi|119871761|ref|YP_929768.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Pyrobaculum islandicum DSM 4184]
    MKTMVVIGGGTAGATAASRAKRLCPQCRVILIEASRYITHAPCAIPYAIGDLTQGEIWLYSEEEFESERGVEVYTETRAV
    DVLGDRVYLEGKLEGVLKFDTLVIATGARPAVPEVEGVELEGVLPVRGVEVVDKAKRLLQGARDVAVVGAGYIGVEMADV
    LAQMGKRVVLIDGSPRPLAKSLDPDMSAVVARYMGERVELRLGERLVKIGGEGGRARYVETDGGRYPADVVFLATGVRPN
    VDLALRAGARLGQTGAVEVNEYMETAAPAVYAAGDVAEARHAVTGEPVWIPLAIYANKMGYVAGTNAGLGRRAISFPPVA
    GASVTKFLDMYIGSTGLTEEEARRRGIYGSSISISATDKARYMKGAVDVTLKAVVDREGRLVGMQIVGRTPSVGGLVDLA
    TQFLGRPVEDMFKAEYSYMPFTASPWHPFTIIARLYLRERLR

    >gi|119872037|ref|YP_930044.1| thiol:disulphide interchange protein, putative [Pyrobaculum islandicum DSM 4184]
    MSSPLKCFKQLFVFIAVFFRKSKLRLTPLTKTEVVKRLLDLAVVKVGNSERVVLVFFDLKCPFCAKLFKETEELLVDMAN
    RGLITYAMCDYVVHRDAEPLHRMLRCISEKERLKFVRDAFEGKRVEIGNCPEGNLRICEKMAEELGVIGTPTLLFYHLAK
    GKGYIHFGYISPTEILEAISSL

    >gi|119872038|ref|YP_930045.1| hypothetical protein Pisl_0524 [Pyrobaculum islandicum DSM 4184]
    MIKIVIHHTCKSSYVLYKALRGVPGITFEMVGTLYFPYLKRYVLSVPAVFANGKLVLVDPVEPGDVIALKDGRTKKELDI
    EEAIENFVRGIMASQAILTAVMLYKSLKPVLDPELVAVLSRARYHEQEDKIGQIVHKLQERGEELLQEHWESFIKLLTFG
    LVRELYWLGIDINELEISHIKMWLLAKATLGRLGLPYPKPSVPDDVATAVYATLKESGQRYMDKIAEEQNIIATDREFLA
    LIQEY

    >gi|119872124|ref|YP_930131.1| thioredoxin domain-containing protein [Pyrobaculum islandicum DSM 4184]
    MDEIDRLLWKKAVEITSRKTQKCCLVSYTPGHVLSDVSQFKNAVMGCRVTFVMFFGKTCPYCQMFDPIFRYIGEKYREYA
    NFVKADIEEFYNIAIRLGIMATPTTVAFLNGQPIEVAPGFMTAPQFKTFVETVLSHAGCK

    >gi|119872125|ref|YP_930132.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Pyrobaculum islandicum DSM 4184]
    MVRVVIVGGGAAGASAAARARRLDPNAEIILIERGSMITHAPCGMPYAIGGVVKSHEDLMTYKPEEFEKERNIRVLIRST
    VTEIDVDKRVVVVERGNNTEKISWDKLVIATGAKPLIPKIPGVELRGILTMRHPDEVPELKAQLETANTVAIVGGGYIGV
    EMAEILLELGKKVVLFEMFNQVLPTALDPDMAAIVADEMKNRGVELHLGEKVVEFSGAGHVSKVITEKGEYKVDKVILAV
    GVRPDVDLAVKAGAKLGETGAVYVNEYMETTVPDIYAAGDVAEKTHRVTGRRVWIPLAPTANKEGQVAGGNSVKGRVLKF
    PGVVGTAVTKFYSLYIARTGLSEREARELGYKVQSTLIKARTKAHYMPGGEPVSIKLVAEESTGSILGAQIVGKSQIVAS
    YADIIALAVQSRYTIEDLFFSDLGYMPDVAPVWHPLIVAARVLSRGKL

    >gi|119872128|ref|YP_930135.1| glutaredoxin-like domain-containing protein [Pyrobaculum islandicum DSM 4184]
    MATPIGGPEEEVPHIEVDEETREIIREMLSQMENPVEINFFTSQNCAGRETNWCIPTEEFLDLLIQLAPQEKLRLNKYLY
    EKDAESFKKFGVEPQRVPVVYFGNGFIRYLGAPLGEEVRAFIETVIRLSTGKTGLRQKTRAELSTLAQSASKRVYILTVV
    TPS
    CPYCPYAVLLANMFAYESKGKVVSVVVEAHENPDIADMYGVTGVPAVILQAEDVSVGDVEFVGVPPEHELLARVKNH
    MGLS

    >gi|119872762|ref|YP_930769.1| UBA/THIF-type NAD/FAD binding protein [Pyrobaculum islandicum DSM 4184]
    MRLVERYSRQIPVIGEEGQGRLRATAVAVFGIGGLGTLVARYVAGGGFRKVVVIDHDVVSIPDIHRQILYTTKDVGKPKA
    EVAARVLSEVNPEVEVVPIAEPISPDLADSILKEVDIAVDALDNWASRHVVNKAAVRHGKPLIHGAVQEWYGHVTTIIPR
    KTPCLEDIFGRFKSLPS
    CAMGFCPVLGPAVGVVASIMALEVFKTALGAPSLVGRLLVVDLKHMTFDLLEIERNPNCPVCG
    VSHSMT

    >gi|119873191|ref|YP_931198.1| thioredoxin-disulfide reductase [Pyrobaculum islandicum DSM 4184]
    MDVDYDVVIVGAGIAGLSAALYTARQKLKTLVISKDLGGQLNMTTLIENYPAIHKISGPELAKRVEQQARAFGAEVIFDE
    VNSIEKVGDIFVVKTWGGDEYKALAVILAFGKTPKELGVPGETKFKNRGVSY
    CTICDAPFFKGQDVALVSWGDLAREPAT
    ILSSIANKFYWIFPSEKPIHDDEFIEQIKRLGKAVFIPNSEVVEIRGDTKVRSIIIKNKKTGEIQEIPVAAIFIEAGYVT
    RSDFVKHLVDLNERGEIIADWEGKTKTPGVFAAGDIVAYPYKQAVISAAMGVAAALSATAYIMKLKGKTVYSLVDWRAEK
    K

    >gi|119873312|ref|YP_931319.1| methylated-DNA--protein-cysteine methyltransferase [Pyrobaculum islandicum DSM 4184]
    MLCVQYGPVVVGWDGEKTHVNPSDCNKWVGLRELVDKIPLEEIDKRLLPLLSIPRGYVTTYKLYAEAIGTSPRHVGWLMA
    TNPLPVILP
    CHRVVKSDMSLGGYTAGVDIKRALLVYEGALCGGRPCRVVKPKPISTIREAVLQSLGLTDKY

    >gi|119873344|ref|YP_931351.1| peroxidase [Pyrobaculum islandicum DSM 4184]
    MPEVKGPYLGMKIPEDLCFSTDAGRRCFRDYRGKWLLLFSHPGDFTPVCTTEFIAFAKKYEEFKKRGVELLGLSVDTDIS
    HIEWKRQIKQLWGVEIPFPIISDVPDFQVANLFNAIPPGTTATVRMVALIDPELKLVWFALYPLTNGRNIDEILRIIDAI
    QFTYKYGYATPADWRPGDPVIVPPPHTYEEAEKRLKEAGIECKTWWFCTKKL

    >gi|119872935|ref|YP_930942.1| heavy metal translocating P-type ATPase [Pyrobaculum islandicum DSM 4184]
    MIRIRFERGRQTTLKIIGMHCATCTLAVQKALLSVPGVLHAEASLAGDEAKVVADPTRLRYGDLLRAVRKAGYDIYREEA
    HIVLKAVRPEEVSRIAELLSGWGVFDVRPNPAAGVVTVEYNPLEVTPGELARKLEEAGYEVAEVKTGEVDIDVDRRVVEL
    DRADLRRRLAVAAGPTAALVALMVASMAGLHAAVYWLQWALATPVQFYSGWRFIKGAYRAFRNKTANMDTLVTLGTLSTY
    FYSVYSLLTGGLVYFEASAAVITLVLLGRYIEAGMRIKTGEAVRRLLTLQPEKARVLENGAEVEVPAAQVKPGQLVAVKQ
    GERAPVDGVVEEGFGYVDESAFTGEPMPVEKKKGDLILAGSILVRGYLVVRATRSGRHTLLAQMVKLVRQAQGARLPVQQ
    LVDKISGVFTWAVIAVASAVFVLWYLTTGDINRALIFTASVLVVACPCALGLATPLSVVVGVGRAAEKGVLIKRPEALQK
    LREARYVAFDKTGTLTLGRPRVVAVWGGDEVLNLAASLEQKSEHPLAAAVVEYARERNLKLSEPEFFDSIPGAGVYGRIN
    GVAVAVGNEKILRGMGAELPPEVAKWAEEMREQGYTVVYVATEGKTLGAIAVGDQIREGAWEAVHWLKTRGVEPVIVTGD
    HEKSARAVAKKLGISVVYSGVDPEEKAKIVEALKSRGLVVFVGDGVNDAAALATADVGIAVGTGTDVAKEAGDTILLRGD
    ITKVVEVFKISEKIMRNVKFNLFWAFVYNIALIPLAAGVFYPVTLRPELAGLAMAFSSISVTLNALRLRGA