Pyrobaculum calidifontis JCM 11548 uid58787

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|126458692|ref|YP_001054970.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Pyrobaculum calidifontis JCM 11548]
    MRFPDVELEAHTGEKVSPARVEKAVVYFFPKAFTQGCTRETIRFNELYDKFKAKGFEVFGVSTDSVETLRKFAEKYGVRF
    KLLSDRGGALASQLGILRPTGTAERVTYILVKGEIIHVLKGLRSADEHADKALSLI

    >gi|126458809|ref|YP_001055087.1| 3-Cys thioredoxin peroxidase [Pyrobaculum calidifontis JCM 11548]
    MSEAKGPYLGMKIPEDLCFNTDHGPKCFKDYKGKWLLLFSHPADFTPVCTTEFVAFSRKYEEFKKRGVELLGLSVDSVYS
    HIEWKRQIEQNWGVKVPFPIIADVDMKVANLFNAIPPGQHLTVRTVALIDPELKLAWFAAYPYTNGRNIDEILRIIDAIQ
    FSYKYGVATPADWKPGEPVIVPPPATVENAAKRLSEPGIECKTWWFCTKKYEAVVKA

    >gi|126458872|ref|YP_001055150.1| protein-disulfide isomerase-like protein [Pyrobaculum calidifontis JCM 11548]
    MRLVNLAIVVVVVLMVAVAVLLVAPLISQSPPQPPQVVNPGGLPIPPWAMRFGNGSAPVVLVEFFDLLCPYCAYAHVELG
    PLIKEKVQEGKLYYILVDFPVHGDAAWALHQPLHCAYNELGPSATLDLVNKLYYVWYLAAIKRAISESDALANMSKTLQP
    YACRFNVTLAQAMGVSDAFGKVGIKIRGTPTFIIYKNGTLTVVEGAYVDKIRQLLSG

    >gi|126459240|ref|YP_001055518.1| thioredoxin-disulfide reductase [Pyrobaculum calidifontis JCM 11548]
    MEVDYDVVIIGAGIAGLSAALYAARQRLKTLVVSKDLGGQLNMTTLIENYPAIPKISGPELAKRVEQQARAFGAEIIFDE
    VKTVEKSGDVFVIKTEGGDEYKALAVILAFGKTPKELGVPGESKFKNKGVSY
    CTICDAPFFKGQDVALVSWGDLAREPVT
    ILSSVANKFYWIYPSDKPIHDDEFIEQTKRLGKAVFVPNSEVVEIKGDTKVRAVVVRNKKTGEVQELPVAAVFVEVGYVT
    KSDFVRHLVDLNERGEIIADWEGKTKTPGVFAAGDIVAYPYKQAVISAAMGVAAALSATAYVMKLKGKPIHSLVDWKASK


    >gi|126459291|ref|YP_001055569.1| UBA/THIF-type NAD/FAD binding protein [Pyrobaculum calidifontis JCM 11548]
    MKVLDRYSRQLPVIGEEGQRAIRNTSVAIFGVGGLGTLIARYVVGGGFRRVILVDFDTVSLPDLHRQILYATHDVGKPKA
    EVAARVLREVNPEVEVEAVAEAISPELAKDVLKRADIGVDALDNWASRHVVNGAALVLRRPLIHGAVQEWYGHVTTILPG
    KTPCLEELFGKFRELPA
    CAAGVCPVLGPVVGVVSSLMALEVFNTAIGAPKLAGKLLVVDLKHMAFEEITLAGHCEHVPQQ


    >gi|126459631|ref|YP_001055909.1| methylated-DNA--protein-cysteine methyltransferase [Pyrobaculum calidifontis JCM 11548]
    MLCASYGPVAVGFDGERLYVNPRCTSWTTLERLVNAVPIEKADKRLLYLLSVPRGAVTTYSLYAEAVGVSPRQVGRLMAS
    NPYPVLLP
    CHRVVYNNGGLGGYSGGGVEVKRALLEYEGALCGGKPCRIVKPHDVDDVVSAVMKSLGLSTTSPT

    >gi|126459998|ref|YP_001056276.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Pyrobaculum calidifontis JCM 11548]
    MAKRIVVVGGGAAGATAAAKAKRVNPGAEVVLVEAGPYVTHAPCAVPYAIAQAARLYIYTAEQFAREKGVVVYTNTKAEV
    GEGGRLRLSGAVSGALEWDAMIIATGASPRVPQVEGVELEGVQVVRHPAEAEAIKKALQPARRVVVVGGGYIGLEMAEVL
    LAGGKDVVLLESGRWILNKMLDEDMARLVEQYIAARGGQLRLGETLTRIVGRGRVERVETTGGSVETDAVVLATGVRPNV
    ELAKALGARLGETGAVWTDEFLETSVPGVYAAGDVAEVVHKVTGRRTWMPLAPYANKMGYVAGYNAGAGEKRVRFPPVVG
    AAVTKFFDMYIGKAGLGEAEARQYGIGATSAVVKTSDKAAFMPDAREIYVKAVASRGVLIGVEVVGFSPYVAAVVDFAAQ
    LIGRPVEEVILAEYSYMPHTGPVWHPLVSAARLLD

    >gi|126460010|ref|YP_001056288.1| dihydrolipoamide dehydrogenase [Pyrobaculum calidifontis JCM 11548]
    MKVVVVGGGPAGYVAAIRAAQLGAEVTLVEEAHLGGECTNWACIPSKALLHMADVFWEVKNSPWARGGVEFDWREAQRAK
    DAVVARLRGGIEKLLAANGVEVVAGKAEPGDGRAVRVGEREVRFDSLVLATGSLPAPLPGAPFGRRVLDTRRALALEELP
    KSLFIVGGGAAGVELAVLFAKLGAEVHLAEAMDRLLPAMDKDLGAYLESRLRKLGVKVYTSAAVEKVEEGPRSVKVHLRG
    GAAEVEYVVVAVGRRPNPGPFAKWVGDVAKVDERMWTGVGQIYAAGDVAGPPYFAHKAYAQGKVAAENAAGRRSFYVQRH
    VPSVVFTDPEVVSVGYTEEEARRAGYEAASVRVPMSAIGRAVAGGRPEGFVKLVFDRKRGVVLGFHGVGPGLSEIAAEAA
    LAVEFSATVEDLALVIHPHPTVSEALAEAAELALGKPTHVLKP

    >gi|126460017|ref|YP_001056295.1| thiosulfate sulfurtransferase [Pyrobaculum calidifontis JCM 11548]
    MPEVLVSTEWVQQHLNDPKVRIIEVDYDPNTAYNVWHVPNAALLTWKEMRHPVIRDFVPPETFEKLMEERGVSNDTTVVL
    YGDFNNWFATYAFWLFKAYGHEDVRIMDGGRTAWAKEGRPTSKEVPSFPRGRYKVKRVDWGSHRAYFWEILQAVTRGEVG
    RRVVLVDVRSPAEYRGDVTAPPEYPNEQTQVGGHIPGAINIPWAQVVDPETGRFKDLSAIRELYEKRGVTPDKEVITY
    CR
    IGERAAHTWFVLKYLLGYPSVRVYDGSSAEWNNLVGVPVKKGDEP

    >gi|126460021|ref|YP_001056299.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Pyrobaculum calidifontis JCM 11548]
    MFLCGSRPCVMPLKVGDKAPDFEALDTDLKPVRLSEVLARGRYVVLLFFPGAFTSVCTKELCTFRDNMAKLAKANAEVIA
    ISVDSPFSLKEFKEKNRLHFTLVSDFNRQVIALYDVVLPKLLHFPLYYLAKRAVYIIAPDGTIKYVWYSDNPLDEPPYDE
    VINTVNKLAAQ

    >gi|126460051|ref|YP_001056329.1| DsrE family protein [Pyrobaculum calidifontis JCM 11548]
    MPDKVAFLATMPPADGPRISTMLGYALAAASMGFEVLIFYTLDAAHIVKKKVFEKLDPQIRERFKQCMDMGCKMWLCSSA
    AATFNIKEDEVVEGVKIMGIASFYEYAAEAKVVLTW

    >gi|126460067|ref|YP_001056345.1| mercuric reductase [Pyrobaculum calidifontis JCM 11548]
    MYDLCVLGGGSAGFAAAIKAAELGAKVVMVNAGLPPGGTCVNVGCVPTKYLAKAAEVVHRAKMGYYPGVKATVEVRLGDL
    LRGAAGVVERLRQEKYIDLLEYYGIDYVEGFGVLASANAVKVGDRTIEARRVLIATGARPAVPAIKGLEEVRYYTNESLF
    ELGEPSSVVFIGGGAVSVELAQALNRLGVKTAIFTRGRLLKYEEEVASHFVEEVLREEGVEVIHDEAVAVRRVDGGVEVV
    GREGSRARGEALFIAAGRRPNSEAAGGLVELNPEGSVKVNERMETSLPGVYAAGDVTGGLPGGRYLENAAARQGVVAAIN
    ALGGDARFNPLHVPRVVFTDPPVASVGMREEDMLKSGVGCVCRLAPVSAVAAAWASGRLDGFIKINTYPQTWRISMRGGK
    IAGAVAAAPQAEELIHIFAMAVAHGLTVDDIADMIPAFPTFGEAARLAALAFYKDVTKLSCCAG

    >gi|126460085|ref|YP_001056363.1| putative inner membrane protein [Pyrobaculum calidifontis JCM 11548]
    MSRVKDFLVKPWRPEVAGLVIGIVASLQILVIRSPWYITGPETQFGGWLLKTLTLGAVKVDLWDYFNPSSPMFVAKALGP
    LENPGFQIVLGFMLGAAIAKALQGAWRLRWPANWGVVITSIIGGLLLGFGARLALG
    CNVGNFFATVQSLVFSGFVFFLGM
    AMGTYVATFLIETWLMDRIAKTRPIRISIGGNVDNRKVLATAVAITAALSLYWWQIGVMAGLLYLLFGVAYGFAGAKADI
    CFTSMLRDGFWSRLAPYGANARAVAIALSITITANLVLKYGVGYSYSEFLFPVGIHTLLGGFLFGIGMVLVAG
    CSFSSAY
    RSGEGSIPHLIAWIFMIIGMTLLAYVWPFFYTTAVALSPVLTLPEMLHGNVAAAAALGYLFCLFLALYPSIRDGTIQLSQ
    LNIKLPKLLITRSK

    >gi|126460302|ref|YP_001056580.1| glutaredoxin-like domain-containing protein [Pyrobaculum calidifontis JCM 11548]
    MSTVPIGPPEEVPHIEVDEETKEIIKEMLSQMENPVEVNFFTSKGCGGRETNWCVPTEELLDLLVQLAPAGKLRVNKYAY
    EQNADVFNKYGVEPHRVPVVYFGDGFIRYLGAPMGEEVRAFIETVVRLSTGKTGLRQRTRGELSALAQNAPKRVYVLTVV
    TPS
    CPYCPYAVLLANMFAYESKGKVVSVVVEAYENPDIADMYGVTGVPTVILQAEDAAVGEVEFVGVPPEHELLAKVKNH
    MGL

    >gi|126460305|ref|YP_001056583.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Pyrobaculum calidifontis JCM 11548]
    MVRVVIVGGGAAGASAAARARRLDPSAEVVLIERGSMITHAPCGMPYAIGGIVKSHEELMTYSPEEFEKERNIKVLIRTA
    VVDVDVDKRVVVVKRGESTEKIAWDKLVIATGAKPLVPKIPGVELKGILTMRHPDEVPHLKGHLEKAKTVAVVGGGYIGV
    EMAEVLLEMGKRVLLFEMFDQVLPAALDPDVAAIVAEEMKSRGVELHLGEKVVEFKGSDHVNKVVTEKGEYQVDEVVLAV
    GVRPDVDLAVRAGAKLGETGAVYVNEYMETTVPDVYAAGDVAEKVHRITGRRVWIPLAPTANKEGQVAGGNAVKGRVLKF
    PGVVGTAVTKFYDLYIARTGLGEKEAAQLGFKVQSSLIKARTKAHYMPNASPVHVKLIAEESTGRILGAQIVGKSQVVAA
    YADIMAVTIQSGYTLSDLFFSDLGYMPDTAPVWHPLIVAARVLSKGRL

    >gi|126460307|ref|YP_001056585.1| thioredoxin domain-containing protein [Pyrobaculum calidifontis JCM 11548]
    MDELDRILWKKAVELTRAKDPPKCCTVNYPPGHVLRDVAQFKNAVMGCKVAFVMFFGKTCPYCAAFDPIFRQVGERYRHM
    ANFVKADIEEFYHIAASLGIMATPTTVAFINGTPVEAAPGFMTAPQFRTFVESVLEHASCRS

    >gi|126460399|ref|YP_001056677.1| thiol:disulphide interchange protein, putative [Pyrobaculum calidifontis JCM 11548]
    MIFRRRKPSLTPVVKTEVVKKIVEIAPIKVGSGNRAVVVFFDLKCPFCARLFKETEEVMLEMAKNGLITYAMCDYVVHKD
    AESLHRALRCIEAEKRLDFVKRIYSGERVKADECPADDLKVCEELAEAVGVYGTPTLLFYDFSKGRGYIHFGYMTPDQVL
    EAIYAL

    >gi|126460401|ref|YP_001056679.1| hypothetical protein Pcal_1796 [Pyrobaculum calidifontis JCM 11548]
    MIKVVLHHTCKSSYNLYKALRGVAGVEFEMAEAPYFHYLANYVLSVPAVFLDGRLVLLDPVEPEDVLALRDGKTEKELAV
    DEAVENFVNGVMASQAILSAVVLHKSLKPILLPELVAVLSRARYHGQEHKTPQIMEALRERERGILEERWERLIKVLTFG
    MVREMFWLGIDVDKVEKSHVKMWLLAKATVGRLGLPYPRPDVPSDVADAVYNVLRESGKRYMEKVAEEQGQILNDAEFLS
    LYRNK

    >gi|126460552|ref|YP_001056830.1| electron transport protein SCO1/SenC [Pyrobaculum calidifontis JCM 11548]
    MSTRSLILLAVAIVLPFVVALVMQSGQTTAEEHSGLFERIVPTCYIPGQEPAAADFTLVDQFNRTVTLSELWSRPVLITF
    TYSW
    CPDVCPTMHLVLNRTLPMIRGYIGAVLDVSLDPERDTPRRLYAYSTGNRYNWTFLTGDPKTLERVWSAYGVYRYVE
    QRPTGPYIVHSVDWIVVKDGKILGRVRGLPSPETLAKYLIDIAERRCGYSAPTPTSQPTTATPPAISTTLIMITAVGAAV
    VAALAKRR