Pyrobaculum arsenaticum DSM 13514 uid58409

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|145590363|ref|YP_001152365.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Pyrobaculum arsenaticum DSM 13514]
    MKFPDVELTAHTGEQISPAKAPKTVVYFFPKAFTQGCTRETIRFNELYEKFAERGYEVFGVSTDSVETLKKFAEKYGVKF
    KLLSDKDGRLSSQLGILRPTGTAERVTYILNNSEVVHVLKGLKSADQHADKALELAK

    >gi|145590729|ref|YP_001152731.1| peroxidase [Pyrobaculum arsenaticum DSM 13514]
    MSEVKGPYLGMQIPEDLCFKTDQGDKCFRDYKGKWLLLFSHPGDFTPVCTTEFVAFSRKYEEFKKRGVELLGLSVDTNYS
    HIEWKRQIEQAFGVKVPFPIIADIDGKVASLFNAIPPGQTLTVRAVALIDPDLKLAWLALYPYTNGRNIDEILRVIDAIQ
    FSYKYGYATPADWKPGDPVIVPPPPTVEAAEKRLKEPGIECKYWWFCTKKYELVAKA

    >gi|145590804|ref|YP_001152806.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Pyrobaculum arsenaticum DSM 13514]
    MKLFVRRITLSEDVVEKLGRFLDTVVVGGGPAGLAAAMYATRFGLSTLVITQEVGGQLTKAVLIEDYMGFQSIQGPELAK
    VFEDHVRKYGVPILLDVVEDIRREDNSFVVRTRDSGDFRSATVIIAVGERRRRLGVPGEEMFNAKGVSY
    CAPCDAPLFRG
    KAVAVVGGGDAAAQAALLLTEYASKIYLIHRRDKLRAQPHYQKLLRHRKIEILWNTIVKELRGDNALREAVIEDVKTGEK
    RVLQIDGILVEIGAEPPAEFFKKIGLETTEDGYVKVNEAMETNIPGLYAAGDCTSAMPRGFKQIQIAAAHGAIAAYSAYN
    YILKLRSA

    >gi|145590808|ref|YP_001152810.1| heavy metal translocating P-type ATPase [Pyrobaculum arsenaticum DSM 13514]
    MEISIGLKVRGRETVLKILGMHCATCSLTVQRALLSTHGVKWAEASLASNEAKLIVDPEVLDYAELLKAVRRVGYDVYRE
    SAYIAAEFRPEEADVVERRAMGWGVFYAKANPATGVVYVEYNPLEINVEDVVRRLEEAGYKVKDVRKGGVEVDIDRRAAE
    LEARDIRRRLIPAVAISILLVPVMFGIELIPQLVQAALAAVVQFYSGWRFISGAFRAFRNKTANMDTLVTLGTLGAFLYS
    TYAAFTGGYTFFETSALVITFVLAGRYAESLMKLRTGDAVRKLAQLQPPKARVRRGEGWAEVDASNIRPGEVVEVREGEK
    VPVDGYVDDGVGAVDESAFTGEPMPVEKRPGDLVLAGTTLVGGRLLVRATRSGNATYLAEVVRLVRQAQNAKLPIQRLVD
    RVSGAFTWAVITVASATLAGWLLLGAPVWQALLFAVAVLVVACPCALGLATPLAVVVGIGRAAEKGLLIKNAEALEKALK
    AKYVVFDKTGTLTAGAPKVIKYVGDELALSLAASAEAKSAHPIGAAVVKLAAEKGLPLAEPEMYETFPGQGVYARVNGAV
    VGVGNEKLVEGMGAAIPEELRREAERHKAEGYTVAFVVVDGAVRGYVVVGDEMRQEAREVVERLRKMGYEPVILSGDSEA
    AVARVAERLGIRRFYGGKTPDEKAEVVKELRKEGGVIFIGDGINDAPALASADVGIAVASGTEVAKEAGDVVVRKGDLTK
    VAEFLDLAKKIMGNARFNLFWAFAYNAALIPIAAGLFYPTLYLRPELAGLAMALSSISVTINSLRLKRA

    >gi|145590812|ref|YP_001152814.1| UBA/THIF-type NAD/FAD binding protein [Pyrobaculum arsenaticum DSM 13514]
    MRLLDRYSRQVAVIGEEGQRRIGQSSVAVFGIGGLGTLVARYVAGGGFKRLYLVDFDTVSLSDIHRQILYTTEDVGRPKA
    EVAARVLKAVNPEVEVVSVAEPISPDLADMIAKEADVIVDALDNWASRHVVNAAAVTHRKPLIHGAVQEWYGHVTTIVPG
    RTPCLEDLFGRFKGLPS
    CQAGYCPVLGPAVGVIASLMALEVFKTALGAPSLAGKLLVVDLKHMSFDVLEVARNPNCPVCG
    RLG

    >gi|145591012|ref|YP_001153014.1| thioredoxin-disulfide reductase [Pyrobaculum arsenaticum DSM 13514]
    MEADYDVIIVGAGIAGLSAALYAARQRLKTLVISKDLGGQLNMTTLIENYPAIAKISGPELAKRVEQQARAFGAEAIFDE
    VKTVEKQGDVFVVKTEGGDEYKALAVVLAFGKTPKELNVPGEAKFKNKGVSY
    CTICDAPFFKGQDVALVSWGDLAREPVT
    ILSSVSNKFYWIFPGDKPIHDEEFIEQAKRLGKAVFMPNSEVVEIKGDAKVKAVVVKNRKTGEIQELPVSAVFIEVGYVT
    KSDFVKHLVDLNERGEIIADWEGRTKTPGVFAAGDIVAYPYKQAVISAAMGVAAALSATAYVMKLKGKPVHSLVDWRAEK
    K

    >gi|145591133|ref|YP_001153135.1| thiosulfate sulfurtransferase [Pyrobaculum arsenaticum DSM 13514]
    MYYMALVTTEWVHQNLNNPKVRIVEVDYDPNTAYNVWHVPGAVLITWKELRHPVRRDFIEPEDFERLMSEKGISNDHTVV
    LYGDFNNWFAAYAFWLFETYGHEDIRLMDGGRTAWAKEGRPTTQEVPRYPKTQYKVRRVDWGSRRAYLWEVMNKVVHGEI
    KKSVLLIDVRSPAEYKGEITAPPEYPNEQTQVGGHIPGAVNIPWGQAVDPNTGKFKPPEELKKLYESAGITPDKEVITY
    C
    RIGERAAHTWFVLKHILKYPAVRVYDGSWAEWGNLVGAPVEK

    >gi|145591421|ref|YP_001153423.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Pyrobaculum arsenaticum DSM 13514]
    MPLPVGTKAPDFELLNEDLKPVRLSEVLKRGKPVVLLFFPGAFTSVCTKELCTFRDKMALLNKTNAEVLAISVDSPFALK
    AFKEANRLNFPLLSDYNRVVIGMYDVVQANLLGLPLYHLAKRAVYIIDKEGVIRYVWYSDDPRNEPPYDEVIKEAEKIGQ
    S

    >gi|145591422|ref|YP_001153424.1| hypothetical protein Pars_1204 [Pyrobaculum arsenaticum DSM 13514]
    MDREACLRRSTSPFVLDGLRSKVQWWAWCEEAFQKAKAEDKPILVDVGAVWCHWCHVIDETTYNDDEIADIINKHFVPIK
    VDRDERPDVDRRLQEYAVLVSGQSGWPLTVFMTPEGEVIWAATYLPPRDYGGLPGMAKVLRAVLEAYRTKKGDIKKMAED
    LSKEIAAWHNPSEAELDRSVQLDILASLAASFDEEYGGFGTAPKFPPITQLDLLLLRHFYDGKSVYGKMAHATLRAMARG
    GVYDQLGGGFFRYSTDRLWLIPHYEKLLVDNAELLSLYARAYAHFGDQLYRKTAAGIIKWLDEFMRDPGGGYYASQDADV
    DGEEGAYYRWTEDELKETLGDLFPKAADMFGLYEFKWPEGRATLSIVRVVPEADLILERLAEARKARKPPRVDTTIYAGW
    SCAMAKAELEASRLAGIGDKEFALKTLDKIRREAWDGSRLARGLRGGGPVGEGVLEDYAYCALAALEAYSHTGRYLDWGV
    EVAGAMVDRFLDQGGFRDVERPDPVLKTPHYPVADTPNYSGNALAILACDLLHYATGIRKFRDAAERALKALAGKLARLG
    PSAAGLAIALDAHLAEPPRTVVVGSAEELLRAALAAYRPLHVVMPVASGWDYPEPSIKAMLAGPKPAAYVCAWGACSMPI
    SDPGRLGEAVRKFRREAYGLE

    >gi|145591423|ref|YP_001153425.1| mercuric reductase [Pyrobaculum arsenaticum DSM 13514]
    MYDLVVLGGGSAGFAAAIKASELGARVVIVNAGLPPGGTCVNVGCVPTKFLVKAAEALRWAQAYFPEANLKPSLRRLLAE
    AAETSAMLRKEKYVDLLDYYGIEYIEGRGVLAGPGRVMVEGRGVLEGKRVVVATGSRPAVPNIKGLGEVGYYTNQRLFDL
    GEPSSVVFVGGGAVAVELAQALNRLGVKTAIVARGRLLKYEEEMASQFVEEVLKEEGVEVVRDEAVAVRRADGGVEVETR
    AGRRLRAEALFVAAGRVPNSEVAGGLLELNSDGSIRVNKRLETSMPGVYAAGDVAGGVWLRGGRYAENAAARQGTIAAVN
    ALGGHEEYDPAAVPRVVFTDPPVASVGVSEDEMITSGIGCRCAAVPIDVVAAAWASKRTSGFIKINTYPETWRVSMKGGK
    IAGAVVAAPHAEELIHVFAIAVKLGLRIGDLAELVPAFPSFGEALRVAALAFEKDVSKLSCCAG

    >gi|145591443|ref|YP_001153445.1| DsrE family protein [Pyrobaculum arsenaticum DSM 13514]
    MADKVAFLATMPPADAPRISTMLGYALAAASMGFEVLIFWTLDGAHVVKKKVFEKLDPQIRERFKQCLDMGCKMWLCSSA
    AATFNIKEDEVVDGVKIMGIASFYEFASEAKITLTW

    >gi|145591773|ref|YP_001153775.1| glutaredoxin-like domain-containing protein [Pyrobaculum arsenaticum DSM 13514]
    MAVPIGEPGEVPHIEVDEETKEIIKEMLSQMENPVEINFFTSGSCGGRETNWCVPTEELLDLLHQLAPAGKLVINKYDAD
    KNADVFRKFGVEPQRVPVVYFGDGFIRYLGAPMGEEVRAFIETVVRLSTGKTGLRQKTRNELSNLAQSAPKRVYVMTVVT
    PS
    CPYCPYAVLLANMFAYESKGKVVSVAVEAYENPDIADMYGVTGVPTVILQAEDAAVGDVEFVGVPPEHELLARVKNHM
    GLS

    >gi|145591776|ref|YP_001153778.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Pyrobaculum arsenaticum DSM 13514]
    MVRVVVIGGGAAGASAAARARRLDPNAEVILIERGSMITHAPCGMPYAIGGIVKSHEELQTYTPEEFEKERNIKVLIRTE
    VVDIDTDKKTVTVRRGGAQETIIWDKLVIATGAKPLVPRIAGVELKGILTMRHPDDVPTIKGHLEKAKTVAVVGGGYIGV
    EMAEVLLELGKKVLLFEQFDQVLPGALDADVAALVAEEMRAKGVELHLGEKVVEFRGAEHVNKVVTEKGEYQVDEVVLAV
    GVRPDVDLAVRAGAKLGETGAVYVNEYMETTVPDVYAAGDVAEKVHRVTGRRVWIPLAPTANKEGQVAGGNAVRGRVLKF
    PGVVGTAVTKFYNLYIARTGLSEKEANALGLKAQSALIKARTKAHYMPGAETVHVKLIAEESTGRLLGGQIVGKSPVVAA
    YADILAVAVQSGYAVSDLFFSDIGYMPDTAPVWHPLIVAARVLSRGKL

    >gi|145591777|ref|YP_001153779.1| thioredoxin domain-containing protein [Pyrobaculum arsenaticum DSM 13514]
    MQYKSAVVDDIDKLLWKKAVELAARDKQPRCCTVNYAPGYVVRGTQLKNAIYGCKVAFVMFFGKTCPYCQMFDPIFRQVG
    ERYKDLANFVKADIEEFYQLAASLGVMGTPATVAFVDGRPVELAPGFMTAPQFRSFVEGVLRYVGCR

    >gi|145591872|ref|YP_001153874.1| hypothetical protein Pars_1671 [Pyrobaculum arsenaticum DSM 13514]
    MIRVVIHHTCKSSYALYKALKGEAGVSFEMATTPYFPYLRQYVLSVPAVFKDGALVLLDPVEPGDVLALRDGRTEKELDV
    DEAVENAVRAVMASQAMLSAVMLYKSLRPVLDPEIVAVISRARFHKQEQKVEQIAKALAEREAEILEEHWEHLVKLLAFG
    LVREMYWLGIDVEEVEKSHVKMWLLAKATVGRLGLPHPVPKVPEEVADAVYAVLKESGRRYLDKVIEEQQIIQSDAEFIS
    LAK

    >gi|145591873|ref|YP_001153875.1| thiol:disulphide interchange protein, putative [Pyrobaculum arsenaticum DSM 13514]
    MIFRKRGPRLTPVTKTEVVKRLLEMAPVKIGNSDKAVLVFFDLRCPFCARLFKEAEETLVEMARRGVITLAMCDYVVHKD
    AEPLHRKLRCTAEDERLKFIAEAFSGKKVEVGDCPEGNLRECERLAEEVGVYGTPTIIFYNFAKGRGYIHFGYMSPSEVL
    EAISAL

    >gi|145592274|ref|YP_001154276.1| methylated-DNA--protein-cysteine methyltransferase [Pyrobaculum arsenaticum DSM 13514]
    MLCAEYGPVTVGWDGRRTYVNPAGCERRVDLRTLVEQVRLAVADGRLLYLLGVPRGYVTTYKLYAKAVGTSPRGVGRLMA
    ANPLPIILP
    CHRVVKSDMSLGGYTPGADVKRALLEFEGALCGKRPCKVVRPAPVADVREALRRSLGLS

    >gi|145591913|ref|YP_001153915.1| hypothetical protein Pars_1712 [Pyrobaculum arsenaticum DSM 13514]
    MRPTIIFTVAIAVFVLLSIAIVYTRLGSPSVQTPSQLGELPLPPWAMSFGNPNAPVTVIELFDLHCPYCAWAHTQLDPLY
    KKLVGEGKLRLIFLDLIVHPDALLAHQYLHCAYRQLGNKTLDMITRLYEAYDPQDTGKQLQLLQQYRCNDAPSATDFENA
    ARALVRYLAQKGVRITQLGTPTFIIIKNGTIEVVVGAQVDRVASLISQ