Pyrobaculum aerophilum IM2 uid57727

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|18312243|ref|NP_558910.1| antioxidant protein, putative [Pyrobaculum aerophilum str. IM2]
    MKFPEVELQAHTGEVILPARTPKAVVYFFPKAFTQGCTRETIRFNELYEQFKQRGYEVYGVSTDSVETLRKFADRYGVKF
    KLLSDKGGKLASQLGILRPTGTAERVTYILKEGEVVHVLRGLKSADEHADRALELAQ

    >gi|18312380|ref|NP_559047.1| thiF/moeB/hesA family protein [Pyrobaculum aerophilum str. IM2]
    MKVLDRYSRQIPVIGEEGQKKIGRTSVAVFGVGGLGTLIARYVAGGGFKKLVLVDFDTVSIPDIHRQILYTSHDVGKPKA
    EVAARVLSAVNPEVEVVPVAEPISPDLADRIMSEVDIAVDALDNWASRHVVNAAAVRKGKALIHGAVQEWYGHVTTIIPG
    KTPCLEDLFGRFKALPS
    CAAGFCPVLGPSVGVISSLMALEVFRTALGTPALAGKLLVVDLKHMTFDIIEIEKNPNCPVCG
    RGARGL

    >gi|18312580|ref|NP_559247.1| senC-like protein [Pyrobaculum aerophilum str. IM2]
    MPRKYILLFLAILIPFVVAVIMQSQLGATAEEHSGLFERVVPVCYLPGREPPAADFELINQYGERVRLSDYWSRPVLITF
    TYTY
    CPDVCPLMNLVLNKTLPLVPNLFGAVFDVSLDPDRDTPERLLAYSRGNRYNWTFLTGDYATLEKVWRAYGVTRYVE
    NRNGVPYIAHDVLYIVVQNGKILGLVRGLPAPETLADYLKKIVSRQC

    >gi|18312835|ref|NP_559502.1| thioredoxin reductase (trxB) [Pyrobaculum aerophilum str. IM2]
    MQMGDLMDVDYDVIIVGAGIAGLSAALYTARQRLKTLVISRDLGGQLNMTTLIENYPAIPKISGPELAKRVEQQARTFGA
    EIIFDEVKAVEKHGDVFVVKTEGGDEYKSLAVILAFGKTPKELGVPGESKFKNRGVSY
    CTICDAPFFKGQDIALISWGDL
    AREPVTILSSVANKFYWIYPGEKPIHDDEFIEQAKRLGKAVFVPNSEVVEIKGDTKVKSVVVKNRKTGETQELPVSAVFI
    EVGYVTKSDFVKHLVELNERGEIIADWEGKTKTPGVFAAGDIVAYPYKQAVISAAMGVAAALSATAYVMKLKGKPVHSLV
    DWRAEKK

    >gi|18313033|ref|NP_559700.1| methylated-DNA--[protein]-cysteine S-methyltransferase (ogt) [Pyrobaculum aerophilum str. IM2]
    MICSQYGPVVVGWDGSKTFVNPSRCSKRVGLAEFLELINIDEIDKRLLYLLGIPRGYVTTYKLYAEVLGTSPRHVGWLMA
    RNPLPVILP
    CHRVVKSDFSLGGYTGGVEVKKKLLAYEGALCGDRPCRVVRPRMIDDVRDALFKSLGLA

    >gi|18313088|ref|NP_559755.1| peroxiredoxin [Pyrobaculum aerophilum str. IM2]
    MKIPEDLCFNTDHGPKCFKDYKGKWLLLFSHPADFTPVCTTEFVAFSRKYEEFKKRGVELLGLSVDTNYSHIEWKRQIEQ
    AFGVKVPFPIIADVDMKVASIFNAVPPGQNLTVRTVALIDPDLKLAWFAAYPYTNGRNIDEILRVIDAIQFSYKYGYATP
    ADWKPGDPVIVPPPPTTEGAA

    >gi|18313293|ref|NP_559960.1| glutaredoxin-like protein [Pyrobaculum aerophilum str. IM2]
    MAVPIGGPEEVPHIEVDEETKEIIKEMLSQMENPVNINFFTSPNCAGRETNWCIPTEELLDLLVQLAPQGKLIVNKYNAE
    KDVEAFKKFGVEPQRVPVIYFGEGFIRYLGAPMGEEVRAFIETVVRLSTGKTGLRQKTRAELSTLAQGAPKRVYILTVVT
    PS
    CPYCPYAVLMANMFAYESKGKVVSVVVEAYENPDIADMYGVTGVPTVILQAEDAAVGDVEFVGVPPEHELLARVKNHM
    GLS

    >gi|18313296|ref|NP_559963.1| NADH oxidase (nox) [Pyrobaculum aerophilum str. IM2]
    MVRVVVVGGGAAGASAAARARRLDPSAEVLLIERGSMITHAPCGMPYAIGGIVKSHEELMTYTPEEFEKERNIKVMINTE
    VVDVDADKKVVVVKKGGSEEKIPWDKLVIATGAKPLVPRIPGVELKGILTMRHPDEVPHLKGHIDKAKTVAIVGGGYIGV
    EMAEVLLELGKRFLLFEMFDQVLPAALDPDVAGIVAEEMKTRGVELHLGEKVVEFRGVEHVNKVVTEKGEYQVDEVILAV
    GVRPDVDLAVRAGAKLGETGAVYVNEYMETTVPDVYAAGDVAEKVHRVTGRRVWIPLAPTANKEGQVAGGNAVRNRILKF
    PGVVGTAVTKFYNLYIARTGLSEKDAAQLGFKTQSALIKARTKAHYMPGAETVHVKLIAEESTGRILGGQIVGKSPVVAS
    YADILAVAVQSGYTVSDLFFSDIGYMPDTAPVWHPLIVAARVLSRGKL

    >gi|18313437|ref|NP_560104.1| hypothetical protein PAE2568 [Pyrobaculum aerophilum str. IM2]
    MADKVAFLATMPPADTPMISTMLGYALAAASMGFEVLIFWTLDGAHVVKKKVFEKLDKQIQERFKQCLEMGCKMWLCSSA
    AATFNIKEDEVVEGVKIMGIASFYEFASEAKITLTW

    >gi|18313448|ref|NP_560115.1| thiosulfate sulfurtransferase [Pyrobaculum aerophilum str. IM2]
    MFIDIDHFKLNEVIIIDARPRIFYTKSHIKDAVNIPISQIMDPLTGMPKPPEELSDVFTNAGIVENVPIVIYDDYPGVNA
    ARLAWTLHYCGLKNVAIIRKFFRYISAHLPIENSNAPPQRGRVRCVQNPNVLADYDTVKNYKGLIVDLRSRREYIKGHIK
    GAVNIPWSDLINNEGFLNDYTWLPHDEEVIVY
    CGQGLYSAIGYVAYADLGIRVRLYAGGYQDWLKHEANQE

    >gi|18313464|ref|NP_560131.1| hypothetical protein PAE2604 [Pyrobaculum aerophilum str. IM2]
    MKIGVIIASDDPMRLYVAATYIATEVARGNEVGVFVTGRGVVPFSKGDLSDYPEAVKMREMKVTWLEIFKAAKPLGVKVA
    V
    CETAAKIYGLTAQDFRHLEIVDEISSMYSFLEEYGEKIVTF

    >gi|18313475|ref|NP_560142.1| mercuric reductase [Pyrobaculum aerophilum str. IM2]
    MYDVVVLGGGSAGVAAAVKAAQLGAKVAVVNSGPLGGTCVNVGCVPSKFLIRAAQLKRYAERPFFKGISAKVEVAFDALL
    QHMKEVVEELRREKYEEVLKYYDVDIIEGYGYLKDAKTVKVGEREVRGEKIIVATGARPRVPEIPGLKEAMARGMAFTNE
    EFFKLDHMPSSIVFIGGGAIAAELSQALARLGIEVAVIYRSSFLKYEEEIASKFVEELLANEGVRLIKAAVTAVEIRGRE
    VEVRHSGGSVRAEALFVAAGRAPNIEPLGGLLKLGPNGGVLVNERMETSLPGVYAAGDVTGGLEGARFLENAAARQGVVA
    AVNAMGGNAKFNPLAVPRVVFTDPAVASVGLREEDMIKGGIGCRCRAAPIEAVAAGWTKGQTTGFIKINTYPETWKVSVK
    RGKIAGALVVAPEAEELINVFAMAIQLGLTVEDLIEWLPSFPSYGEALRLAALAFYTDPTKLSC
    CGG

    >gi|18313483|ref|NP_560150.1| putative inner membrane protein [Pyrobaculum aerophilum str. IM2]
    MPLPKFLKEPWRPEVAGALIGLVAVLQIIVVRSPWYITGPENQFGGWLFYVLTGGLLNTKEWAYFNPNSPMFVAPAAAPW
    EPANKEFMIVWGFMLGAMIAKAIEGNWRLRWPANRMVVLLSIIGGLMLGFGARLALG
    CNVGNFVATIQSLVFSGFVFFLG
    MAVGTFISTRLIEDFLMEKMHKSKPIRIELGSNVDNRKVLAFALAATLLTTLYWWGLGIWAAIAFLYLGIAYGFFGSKGN
    VCFTSMLRDGFWSRLAPYGGNARAIAIALAIMITGNLVLKYGFGWQYREFLFPVGVHTFLGGVLFGIGMVLVAG
    CSFSSA
    YRSGEGSIPHLIAWFGMVAGMTILSYVWPFFFTTSIYLSPVLHFYDFFGGNVAAGAAAAYSVALFIALVGSWRDGTLQRL
    VQIPPLKILAPRLHV

    >gi|18313492|ref|NP_560159.1| pyruvate dehydrogenase E3 (dihydrolipoamide dehydrogenase) [Pyrobaculum aerophilum str. IM2]
    MKVVVVGGGPAGYVAAIRARQLGLDVTLVEAERLGGECTNYACIPSKALLHAAEAYRRAVSSPWITGTVSFRWKEAVQWK
    EKVVEKLRRGIEFLLSAAGVEVVRGLAKPGPGKTVEIDGRRLQYDFLILATGSEPVGLKELPFGRRVIGTREIFSLEEPP
    ASVAIIGGGASGVEIASLFSMIGAEVHVVEAMERILPGLDPEISRQMERALSSRGVKIYTSSRVVKGEEGEGSVKLRISS
    PGGEREIEAELAVVAVGRRPRPGPFSAMGLEVDGRGAVRVDESMRTSVPWVFAAGDVTGPPYFAHKAYAQAKVAAEAIAG
    LKSAYSPRSVPAVIFSDPEVVSVGMTEEEAVAKGYRPKAVRMSLSALGKAVAAESEGGFAKLIYDAESRIILGVHIVGRG
    VSELAGEASALVEFYATVDDLALTIHPHPTLSELFAELAEAALGKPVHIAKL

    >gi|18313540|ref|NP_560207.1| hypothetical protein PAE2717 [Pyrobaculum aerophilum str. IM2]
    MDARERCLSSSSSPFVLEGLKSRVKWWGWCKEAFEAAEREDKPVLVDVGAVWCHWCHVMDERTYNDEEVAEFINKHFIPV
    KVDRDERPDVDRRLQEAAQLISGQSGWPLTVFMTPKGQVIWAATYLPPRREMGLPGMLEVLEAVLRAYREKRGEVEKFHE
    DLARELKKWHSPSPGEPRREGQAEVLAALAASFDEEYGGFGGAPKFPPITQLELLMMRHFYDGVGIYGKMAERTLDAMAL
    GGVYDQLLGGFFRYSTDRSWLIPHYEKLLIDNAELLAVYTKAYRQFGKALYKRTAEGIVKWLDEFMRAPEGGYYASQDAD
    VDGEEGGYYRWSLEELKELLGELYPVASKHFGLEEYPWPEGKATLRVARPLEGPEAERIYQILIEARRKRKPPFTDTTVY
    VGWSCAMAYAELLASRLASVGNKYHAVRTLERFGVELGQRGRLPRGFRGGGPVGIAALEDYAYCILAWIEGYSHTAKLEF
    LKVAESAGEILLAKFLEEGGFKDVETVDEIIPTPNYPALDTPNFSGNAVAAIALATLSEVTGDAKYKEAAYRAVSALYGK
    MERVGPAASGLWIALDLLTLGVPRTVIVGESPELITAALRAYRPWHVVVPITGNWPYKDPAVRAMLNGPKPAAYICAGGA
    CSLPVREPERLEKTIEEFMKTKYALPL

    >gi|18313548|ref|NP_560215.1| bacterioferritin comigratory protein [Pyrobaculum aerophilum str. IM2]
    MVLKVGDKAPDFELLNEELKPVRLSEVLKRGRPVVLLFFPGAFTSVCTKELCTFRDKMALLNKANAEVLAISVDSPFALK
    AFKDANRLNFPLLSDYNRIVIGMYDVVQANLLGLPLYHLAKRAVYIIDPTGTIRYVWYSDDPRDEPPYDEVIKEAEKIGA
    QK

    >gi|18313549|ref|NP_560216.1| thiosulfate sulfurtransferase [Pyrobaculum aerophilum str. IM2]
    MAEVIVSTEWVQQNLNNPKVRIVEVDYDPTTAYDAWHVPNAILIAWKELRHPVRRDFIEPADFERLMSEKGISNDHTVVL
    YGDFNNWFATYAFWLFQAYGHEDVRIMDGGRTAWAKEGRPTSREKPSFPKTQYKVRRVDWGSRRAYLWEVMQKVLHGEVK
    KNVILVDVRSPAEYRGEITAPPEYANEQTQVGGHIPGAINIPWGQAVDPETGKFKPPEVLRRLYESAGVTPDKEIITY
    CR
    IGERAAHTWFVLKYILKYPAVRVYDGSWAEWGNLVGAPVEK

    >gi|18313558|ref|NP_560225.1| thioredoxin reductase (trxB) [Pyrobaculum aerophilum str. IM2]
    MKLDLRRITLAQDVLEAVGSQLLDVIIVGGGPAGLAAAMYATRFGLNTLIITEDVGGQLTKAGLIEDYLGFRSVQGPELA
    RVFESHVRKYGVSILLDKVEDIRRDGGSFVIKTENSGDFRSLTAIIAVGERRKKLGVPGEEEFNARGVSY
    CAPCDAPLFR
    DKVVAVMGGGDAAAQAALLLTNYASKIYLIHKRDRLRAQPHYQKLLNHEKIEILWNTIVKELRGDKALREAVIKRTDTGE
    EGVLKIDGIFIEIGAEPPAEFFKRIGLITTDDGYVKVNEAMETNIPGLFAAGDCTSAMPRGFKQIQIAAAHGAIAAYSAY
    NYILKLRGG

    >gi|18313861|ref|NP_560528.1| thiol:disulphide interchange protein, putative [Pyrobaculum aerophilum str. IM2]
    MIFKRQKPRLTPITKTDVVKRLLDLAVVKVGNSDKAVLVFFDLKCPFCARLFKETEEILVDMAKRGLVTFAMCDYVVHKE
    AEPLHRKLRCLSEEERLKLISDVYSGKRVDAGECPEGNLRECEKAAEEVGVYGTPTILFYNFAKGRGYIHFGYMPPSDVL
    DAISSL