Picrophilus torridus DSM 9790 uid58041

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|48477193|ref|YP_022899.1| thioredoxin [Picrophilus torridus DSM 9790]
    MILQFKNNMDEDLEKIKRARLNEIMNELQNRIKTLNESNFGTFVSEGVSVIDFWAPWCAPCHILSPLIEDLAEKYTKVKF
    GKVNGDENMRLLYQYNITGLPTVLFFKNGMLADRSVGVVPENVLEEKLKWLL

    >gi|48477215|ref|YP_022921.1| peptide methionine sulfoxide reductase [Picrophilus torridus DSM 9790]
    MEDVCYLAGGCFWCMEAVFKDIYGINDVQPGYAGGTTVNPTYEEVCSQRTGHAETVRIRYDPEKISFDDILEIYFSVIDP
    TTLNRQGEDVGTNYRTAIFYINEYQKERAVNYIKNLEASGKYSKIVVSVEPYKNFYPAEDYHKNYFERHPEQGYCRVVIK
    PKVEKVRQKFFYKINNQ

    >gi|48477336|ref|YP_023042.1| mercuric reductase [Picrophilus torridus DSM 9790]
    MNDYDLGIIGWGAAGFAAAIRASELTYNGMRIALIGNGDLGGTCVNVGCVPSKYLIEASKEYNHALKPRYPGISSSAGVN
    FHELMSSLRSFVLKSRENKYTNVIKNFHNIDLYRGKASFISKNEVMVNNIKIRATNFIIATGSRPYIPENIKNYITSDDL
    WSLDEIPKRLAIIGSGAVAMEMAYAFSNFGSDVYVFNRSNHVLKNFDSDINKMLIDHMKGLGVKFIFGDIKEADHDYVIS
    DRKYSGFDKILAATSRVPNIDINLEAASVDYKNGIIVDDHLRTSNKMIYAAGDCVDQRFQLETLAGREGVIAVENILGLD
    RSIDLINVPWAVFTEPNVASTGYTERELKKYKKRVLYLKNVVKSNILMEDGLVKMLTDDEDHVLGVQIFAPYAAEFIPEA
    YNIIKNHGTYKDFIEAMHVFPTVSESLKITAQSFIRDVSMMSCCME

    >gi|48477350|ref|YP_023056.1| membrane spanning protein [Picrophilus torridus DSM 9790]
    MIGVTAYEWIGLFIGIIIGGLAEAWGISNPEVLIRLGRWKDRLFVGCIAIAIGAGAIALYGLSFAGVAFHWGIKPDYIVG
    VALGGAIFGTGIAISGYVPGTIWMALGEGRRDALYAVLGGLLGAASWTLIYQTSFGQWLVSYLNFGEIYFGGTVDTNLAA
    GFGIAIVWAIIMFTIAYTLPRYKNGKSCAYTSLHKNYRMSTEEEKEYAETAAMLLEGSSMPLGKNNLPEKVNYHWTVSSK
    LFGVVMMSVGIIIGLTVVLEMFLHQIFGESTTYSWIVAKIWLPAGYWKYSTLVVHTIGWEPFSDIGTLFGAFLASIFFTR
    RFQSFNNVIPPSWRKRFGNSQIKRAAGAFSGAFLMLLGARMADG
    CASGHILSGDLQMAVSSLEFFVVVMVFLLMVSHIIY
    RRVD

    >gi|48477441|ref|YP_023147.1| glutaredoxin related protein [Picrophilus torridus DSM 9790]
    MALIRDEDRKYLEDEFNGKLKEPVDLVVFTSNKSDCKYCKETVQLAEELSSINEKINLIKYVYEDNKDAVNDYGVEKYPA
    TIVAKHGQKDGRIVYYGIPSGYEFGSLIEDIENVSMNEADVSKHAMELISKVDRPLTIKVYVTPT
    CQYCPRAVGTAHKFA
    LLNKNIKAEMIESLEFDKEAEEVGVSAVPHVVINDDVTFVGAQPDDQFAEFIMEAYNHQD

    >gi|48477449|ref|YP_023155.1| putative peroxiredoxin [Picrophilus torridus DSM 9790]
    MEGKMPLIGEKFPEMEVVTNLGNIKLPDDFKGKWFVLFSHPGDFTPVCTTEFFSFAKHHDDFKKLNTELIGLSVDSKISH
    IEWINWIKQNLKIDIKFPIIADPMGHVATKLGMIQAQSATQTVRAVFIVDDRSTIRAILYYPMETGRNISEILRLIKSLQ
    MVDKYKIVTPANWPNNEIIGDNVLNPPPATQNDIEERTKKYKGYAWWLTYQDANKADVDEAKEITGE

    >gi|48477475|ref|YP_023181.1| alkyl hydroperoxide reductase [Picrophilus torridus DSM 9790]
    MLKVGDNAPDFEAISDSNEKIRLSDEVKKHRVVLYFYPKDDTPGCTTEACTFRDNYNELLSLGGNVIGVSSDSIESHRKF
    KEKYRLPFTLISDPDGKIRKLYDATGLMLPPRITYVIDKNMKIIEAFNSQMRPRDHVEISINALKSKN

    >gi|48477514|ref|YP_023220.1| bacterioferritin comigratory protein [Picrophilus torridus DSM 9790]
    MELLKVGDTAPDFETVDQNGKTVKLSDFRGMPVVLYFYPKDNTPGCTVEAKNFRDNMDIFDSRVKVIGVSVDSQESHMKF
    HEKLNLNFDLLSDKSKEIVKKYGVLGVSTAKRVTYIIDQNGKIAHVFEKVKPDGHAKEVYEKLKELKLIN

    >gi|48477593|ref|YP_023299.1| molybdopterin biosynthesis MoeB protein [Picrophilus torridus DSM 9790]
    MRYSRQEIIKFIGKNGQKKIRKTKALVIGAGGTGSYTIMSLAMLGFGRIHVIDDDKIEITNLNRQALYNEDDLGSYKAET
    IFKRIKKINSLVNISYETSRFDSSNYEIVKDFDIVFDCTDNITTRMIINDACDKFRIPWVFMAVSEFYGQVKLINPGITA
    CFACYNRDPGEIPN
    CDVTGIVATTASIVSSLAVNTAVKFILGNTDEDLLLIDSLNMSIEKIKINKNEKCRSCSLHDYKYL
    GRYYSNLKGIIP

    >gi|48477618|ref|YP_023324.1| dihydrolipoamide dehydrogenase [Picrophilus torridus DSM 9790]
    MDYDVIILGAGAGGYKAAVHLLKNKKRVLMIEKEKFGGECLNYGCIPSKALIEMSESIYYLKNMPGISMEYKIDMKAWQD
    WKNSMVARITGNAERQCKSLGADILYGFGTLKDKNTVNVNGKDYTAENIIIDTGSSPARIPGIDNVYYNREILGIDHIPE
    SIAIIGGGYIGVEIGTAMAKLGSDVYIIEAKERILPEVSSELSNAVDKKLRSIGVKIMTSSKVISVSKDKYYTVKTENDE
    IKSEMVLMSVGRIPNTKNIGLENLKIEMDGRFIKTDEHRRTNVKNIYAIGDVTTGPMLAHKAFYDAYIASENILGNDVII
    DYKAMPYVIYTDPEISFTGSVSNNSKKIMTSAVPRALTMNEGDGFFRIYYNDDGTVTGAAIAAPRSSEIITEISLAVESY
    LNINDLLLTIHPHPTIAEGIHDDFEN

    >gi|48477799|ref|YP_023505.1| putative peroxiredoxin [Picrophilus torridus DSM 9790]
    MPVYLGKRAPDFTANTTRGVISLSDYKNKWVLLFSHPADFTPICTTEFIEFSRRYNDFKELNVELIGLSVDSLQSHIEWL
    KDIYEKFGIEIQFPVIADINKEIAREYNLIDENAGNTVRGVFIIDPNQTVRWMIYYPAETGRNIDEILRSVKALQANWSR
    KIATPVNWRPGDKGILPPPSTLEDALQRIREGNKTWYIKTE

    >gi|48477806|ref|YP_023512.1| thioredoxin reductase [Picrophilus torridus DSM 9790]
    MMNFNIRGNERNYETDYDVIIIGAGAAGYSAAIYAKRSGLNVAILEREAVGGGNTAVSPLVENYLGFKAIEGADLAREFE
    KHAREYAKIITEIEARSIEKTSDGFKIKTNREDFTSRYIIITTGTTHRKIGVPGENEYYGKGVSY
    CSTCDGYLFKDKRVA
    VIGGGNSGAISAIYLNGIASDTRIISHSDRYKCEDAYVETIKEKNIPFILNAETTEIIGDGKKVTGLKYTDKKTGKETEI
    EVDGIFVYVGIVPQTEFLKGSGVKMDDRGFIIVDDKMRTSVPGIYAAGDVVKGSEEQIATAVGDGCRAAITMYTDNMHK

    >gi|48477891|ref|YP_023597.1| rhodanese-related sulfurtransferase [Picrophilus torridus DSM 9790]
    MFEFITDYFKDPENLEILGPKDVIESLKNKDAIIIDVRTKYEYSSGHIKSAINYPLGHEGDIEKEIPKNTRIILICKTGH
    RSRAAANRLTRMGYKNLAHLEGGMDNWKKQNFPVVK

    >gi|48477959|ref|YP_023665.1| dihydrolipoamide dehydrogenase [Picrophilus torridus DSM 9790]
    MKEYDVVTIGAGGAAYPAAFKLKRSGYNVIMIDKKGVMSGNCLSEGCVPSKAIIESVHKYNTLKGIFDFKVDYKKIVDHK
    DSVQRLRYSDHDRELGEADLKIIKGTGRLVDENTVEVDTGTGIERYHADNIIIATGADTFIPNIKGSELAVTSRDFYSMD
    PKIKSVPESITIIGGGYIGVETGSFLSILGSRVTIIEMLDRILESMETDIIDKLIPLLPRMDVKTSSEVKSIEKFNDKLK
    VLLNDGEVVSDMVMMAAGRHPVLPEGLDDLGIKYTKHGINVNMSMQTNIKNIYATGDVNGITPLFHAAKRQSIIAANNIM
    SGNVPVDYFDPISVPFTLYTIPQLAYVGILPAQAERLGIEHYEATYDMKKDSLAEINNEVYGEITLVFDKRMKIIGGYVI
    GNDAGNIINEIALCVSRGLSLRDLAEMSHQHPMSFEGLDSAARKFY

    >gi|48478111|ref|YP_023817.1| formate dehydrogenase alpha chain [Picrophilus torridus DSM 9790]
    MGTLTIEKNRYNFLEGDTLLNVFIKAGIDIPHVCYNPALGPLQSCDTCIVSVNGRLVRSCSTIAEDNMNIEYKNNDVKNA
    QIEAINRLLREHNLHCTVCENNNGDCALHNAVDSSGLERQKYKYEKKPYEIDDSNPFYRYDPNE
    CILCGRCVEACQDVEV
    NETIHIDWTLERPRVVWDDGKMINESSCVSCGHCVTVCPVNALMEKSMLEEAGYFTSLTRKAKESLIDFGKNLEDQLTIR
    PIMEISNIEARMRNEQIKKTKTVCTYCGVGCSFTMWTKGRKILKVQPEIESPANGISTCIKGKFGWGFVNSDDRLKRPLI
    RKNNKFVEVSWDEALDFAAAGLKRISDKYGGDSIMFIASSKGTNEEAYLIQKMARQIFKTNNVDNSSRF
    CQAPATTGLWR
    TVGYGGDAGSIDDIYNSELVMIVGANTAESHPVIATRIKRAHKLNNQRLIVIDLRRNEMAQRADLFLHPRPGTDLFLLSA
    ITKYIIDNNWHDKKFIEERVNNFDEYYKSLDNFTLENAEKITGIDKNEIIKVASMIHSVKSMCILWAMGVTQHSAGSDVS
    TAISNLLLITGNYGRPGTGAYPLRGHNNVQGASDFGAMPTYLPGYQSIKNKDAIKKFEKAWNTKLPMNPGIDNVSCIENI
    DNDKIKAMYIIGQELAETGPDTNMINKSLEKLEFLIVQDVFFSETARYADVVLPSCVSLEKEGTYVNTERRIQRIYKVME
    PYAETRPDWEIIQDIARRLGYNWNYKSPSDIMDEAASLCPIFSGVSYSRLEGFNSMQWPTYENGDSSKYLYKDGFNFPDG
    RARLYILKYRPPIMEDDDYPLHLNNGRMLEHFHEGNETFKTPGIRDKVPDTFLEISPELADEYNIKTGDFVRVTSRYGSI
    KVRALVTDRVKGKELYMPMNAASSDNGINLLTSYSRDPDSDTPAYKELPVRIKKLKDNGGSPLPKTNPRFGTPVPQIGIN
    IEMKWKRADYKKITGD

    >gi|48478141|ref|YP_023847.1| DNA-binding protein [Picrophilus torridus DSM 9790]
    MDAKKKLEEVTRVMNAIGSDDSKVQSSFIGFMSYVMSPGSLDAKTKNLIAISLSIAAKCDWCVSYHVNNALKAGATKDEI
    MEAAYIAVLMFGSPAMMEINRVLDTLEQLGK

    >gi|48478251|ref|YP_023957.1| rhodanese-related sulfurtransferase [Picrophilus torridus DSM 9790]
    MVNDIYPEDLNKLENKVIIDVREPFEYDEMHIKDSILIPMYKIPDNIEKIKNMNKNIVLVCASGHRSIYVASYLEQNGVK
    NVYNLAGGIYSLYFSGFPLVTAYDE

    >gi|48478320|ref|YP_024026.1| putative peroxiredoxin [Picrophilus torridus DSM 9790]
    MVNENEKAPDFEAPDMNLKMVRLSDFKGKNVVLAFFPGAFTSVCTKEMCTFRDSMANFNKLNATVLGISVDAPFSLAEFA
    KQNNLKFDLISDSTREISRKYDVLYNSFLNIKNLQASKRSVFVLDRDGIIRYKWVSEDPGREPDYKKIEEVLSSLN

    >gi|48478494|ref|YP_024200.1| thymidylate kinase [Picrophilus torridus DSM 9790]
    MNHLKNERSPYLLQHASNPVDWYPWSEQAFEKARSEGKLIFLSIGYSSCHWCHVMENESFKDDLVARKMNKTFVSIKVDR
    EEMPDIDNYYITLSQLMTGQAGWPLNFILSPEKKPLFAFTYIPRETRNNMIGMLDLCDTIDYLWNNKRDELLENANKAIN
    AIKNEIKPERIDYNEAIENTFYSLKRTFDIEYGGFGSAPKFPEYHKLIFIMLYHKYFHGDIHMAVKTLTEMRLGGIYDHV
    SGGFHRYSTDSMWIVPHFEKMMYDQAFAVLAYTQAYQLTGKKLFMDTVHEITDFVNNEFFGEAFYTAIDADYKNIEGYYY
    TWDYNDIKDIIDDDFINDFNIKPEGNFISDKISGRNILYLKSEDKLNEKNMKILKKLKEKRVDSPFKDKKILCDVNGMAI
    KAFSYAYSVFKDRKMLDMARSAADFILYEMYQDGKLYHSYMNGLGPLANFDDHAFFISGLIELYNITNEKKYIDAAVQLN
    KKCIDLFYDGNGFFNSTGDFRMKEYYDSAVPSGLSAELQNLILLSFIDNNLNVFERAIDSVGYIIKNNPAFASAIVSSLI
    YYKYSYNIKGSKDFIENIEKKYVPSRLIELSNENQVCDMNKCIYNPDEIEKILR

    >gi|48478501|ref|YP_024207.1| O6-methylguanine-DNA methyltransferase/endonuclease V [Picrophilus torridus DSM 9790]
    MQSIDLYSYLYSLLGQIPEGMVTTYGDLAVALGDVKAARACGYMLSRNNDTENIPCYKVIMSDGSLGGYSLGIDEKIRRL
    RNDGIEINNGRIDLKRYRFNNFDSSYPLKRLQEEQEKIAGLAVYSDDYNEDKICAIDVSYKDEIGYSVMVSFENNEYDFK
    TFIKETRFPYIPGYLAYREFPYIKELGKNFDGTMIIDANGLLHPRRCGLATYVGVIMNKPSIGVAKSLLTGSIKNGYVYY
    NNMPLGYMINSRTIVSPGNRISLESSINFIRNLGKDHYPEILKIAHDRTVALRRNNII

    >gi|48478551|ref|YP_024257.1| NADH dehydrogenase [Picrophilus torridus DSM 9790]
    MKILVIGGGAAGMSAASKARRMDRDADITVFEDGPFVSYAECGMPYYLAGYFNDYNDLLHYKIEEFTEKRGINVITNEKI
    KDVDVKNRIVYSKNRSYEYDKLVIASGASPRIPDEFKDYALSLRSMEDAIRLNDMLKRSRDITIVGAGVLGTELYSLLKK
    RHHVRLISKHDHVLPYFDDDMSDILKNICDDNIEYNSLPIEISYNGRYKIKTSLGSHESDLVIFATGIEPNTSFIKDGIK
    KDGYGRIIVDDYLMACDDVYAAGDAVTTKNIVTGLNDYFPLAQVANKMGRIIGVNLFGNRIKFPGSLGTTIINLNDYQVG
    YTGINERTARKLNIKYDRILIKGESRSKYLHGSDVYTKIIYSEDGRLIGAQVISRENGAWRLNVLATAIYSKMHIDDLFF
    NDLGYEPEYGPVWDPIVVAGSLGLDKLQGYGK

    >gi|48478594|ref|YP_024300.1| alkyl hydroperoxide reductase subunit c [Picrophilus torridus DSM 9790]
    MLAIGNTAPDFESPTYFPETKEIKNVRLSDYRGKWVILTFYPGDFTFVCATDIEALMGSYDKFLKENAQIFAISEDSVYS
    HKAWSDTSPRVSKSKIPLIDDFNKKIASAYGFLTAAGTAQRGLVIIDPEGKVQYMAMFNDGLGKDVKHIYAAFMGLKTLH
    DTKEPEGHMCAIPANWEPGEEVLDINVVNDIGKL