Nitrosopumilus maritimus SCM1 uid58903

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|161527718|ref|YP_001581544.1| thioredoxin [Nitrosopumilus maritimus SCM1]
    MGITQISDAKSWEVDVINSDLPVFVDFWAEWCGPCRMVGPVVEELASDYDGKVKFVKVNVDEANELASKYNVFSIPTLIL
    LNKGEIVSQQVGAASKESYKNMIDRALA

    >gi|161527738|ref|YP_001581564.1| thioredoxin [Nitrosopumilus maritimus SCM1]
    MSEDPEIEKIKQRKLEEMLKQQNQPKVEPGIIDLNDSNFDQTILAENPTLVDFWAEWCGPCKMMHPVFESLSKKYPKVKF
    ARVNVDNNQNIAMKYAVQSIPTFIMFKSGQIVDKMMGAVGAPGINMICQKHSQ

    >gi|161527783|ref|YP_001581609.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Nitrosopumilus maritimus SCM1]
    MSLNVGDTAPNFELPDTELKLRTLDEFKGKKIVLTFIVAASSPVCETELCTLRDSWQEIADTGAQIVAISNDGPFANKAF
    AEKHNFNFPLLGDYNSKTISDYDILMKDLLHIKDYNAAKRSVFVIMEDGKIGYKWVSEDPLKEPNYEEIKNFLK

    >gi|161527896|ref|YP_001581722.1| methylated-DNA--protein-cysteine methyltransferase [Nitrosopumilus maritimus SCM1]
    MNLEKKIYKKLLEVPKGQITTYGELAKAVGLKNGQRAVGRIMNKNPYPVIIPCHRVVMSNGKVGGYAYGEHIKTKMLNDE
    GIKIENGKILDWEKTVYRF

    >gi|161527949|ref|YP_001581775.1| rhodanese domain-containing protein [Nitrosopumilus maritimus SCM1]
    MSYAHPEVLVDTEWVSQNPPNENRKLVEVDYDPVNGYQKGHISGASLIWWKRDINDPVTRDIISKKQFEELMAKNGITKD
    TEVVLYGDFNNWFAAFVFWVFKIYGHENLKIMNGGRKKWELENRDYTTDEPQFESVTYDAQPPDEGLRAYLFDVSRALGK
    EDTVMVDVRSPAEFSGEITAPPEYPMEHAQRGGHIPDANNIPWATAVNDADGTFKTVDELKQNYEPKGVTPDKDVICY
    CR
    IGERSSHSWFVLKYLLGYPKVRNYDGSWTEWGNMIGNPVEK

    >gi|161528068|ref|YP_001581894.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Nitrosopumilus maritimus SCM1]
    MIEEGEKVPKFEVSDSNGNKVKSSDFKGKKHVIYFYPKDFTPGCTTEADEFAKDYKKFQKEGIEIVGVSPDDVDSHKKFC
    DKMGIKFPLLADVDKEISKSFGVWGLKKFMGREYMGVMRSTFLVDEKGKIFKIYPKVKPAGHSKQVFEDFKNLE

    >gi|161528147|ref|YP_001581973.1| DSBA oxidoreductase [Nitrosopumilus maritimus SCM1]
    MNKKGVIIGVVAIAIIAGVAASLSATPAETVNLDMTRTHGTISTAMGSPILGDPNAPITIVEFGDYQCHQCYNWFHNTKP
    TITRDYIDTGKANLVFVDMAFLGRDSSPAAQATYCAEDQGMYWEYHDMLYNAQESKIDGGWANNERLKAFAFSMGLDMEL
    FESCLDSGKYSKRVQYNTQQARDHNVRGTPGFFIVGPDGQQQIGGAQPFSVFKQVLDPMV

    >gi|161528163|ref|YP_001581989.1| DSBA oxidoreductase [Nitrosopumilus maritimus SCM1]
    MPTKIVIAAAVIVVGIAMSIYAVTGMDMNTKVAEAARVDVENIKQYSHSLGNSNAPITIIEFGDFQCPFCSEWYKETAMP
    LKEKYIESGQVELVFVDYPFLGDDSYPTAHASYCAEQQGMYWEFHEILYLNQGDTNDGWASADKIRDFASQINLDMEKYD
    ECMSSSEFNQKIDQSLKLGEVHEVNQTPTFIVVNERGEYQKIEGKQPLVVFEELMQKMK

    >gi|161528180|ref|YP_001582006.1| thioredoxin reductase [Nitrosopumilus maritimus SCM1]
    MMAADAGSTVLESKDDGPKMPDKKKTKFDVVIIGAGPSGYTAGIYCSRAGYDTLILSGILPGGQLVNTTEVENYPGFENG
    IMGPDLMIEMRKQCQRMGTTIVDDEAVDVDFRRKPLKVLTASEEYEGRAIIIATGANPRKLGLEGEETFGGKGVSY
    CATC
    DGPFFRNQELVVVGGGDSAVEEATFLTKFATTVHLVHRRDELRASKVMQDRAHSNEKIKFHWDSAVVDIKGDQKMQQAVL
    KNLKTNEESTLDVGGLFVAIGHEPNTKLFKNQIDLDDEGYVVLKNKTHTNVEGVFAAGDVHDRSYRQAITAAGYGCMAAI
    DVDKYLTESADNQE

    >gi|161528188|ref|YP_001582014.1| rhodanese domain-containing protein [Nitrosopumilus maritimus SCM1]
    MTESGNITTDVDSLRSEIRDKSVRVIDVRREDDYKKDHISTAVNLPLANLLSDDSPERVVKLVNSMGIDDETRVVVYDDT
    FGALASRVAWTLEYLGHSDVSLLETTYSNWKSLGLESDSDTPDIQSKEHSMNLQSDILATSDYLESAKERDDVILIDNRE
    RLNFLEQHIPGAISLPYRTLASNDKILRPKEDMKRLLDNRGVSGNTEIITY
    CGSVGTLSGLAYYALKTAGLPNAKLYVRS
    FKEWKNLQKPTAKQEDANYWDLSAE

    >gi|161528205|ref|YP_001582031.1| methionine-R-sulfoxide reductase [Nitrosopumilus maritimus SCM1]
    MSEKIRKTPEEWKDQLTPDQYEICINHGTEPPFSGKYNNTKLEGKFKCTCCGEELFSSDAKFDSGSGWPSFWEPLSEDKI
    EYISDTSYGMVRTEVNCNKCGAHLGHVFDDGPKPTNQRY
    CINSISLQHEKDEESQ

    >gi|161528325|ref|YP_001582151.1| redoxin domain-containing protein [Nitrosopumilus maritimus SCM1]
    MKSEIKTALILGIVIAVGIGITSIVFSTIENNIQTANNFDSANSASKIDKSGFKKAPDLVGIAHYLNTTPEELAQEIEGK
    VVLYDIWTYS
    CINCIRTLPYITAWDDKYSDQGLLIVGVHSPEFEFEKVPENVQMSIEKHGINYPVVMDNDMETWKAFENR
    YWPRKYIADHEGYIRYDHIGEGGYQETEKIIQQLIKERSDSLGIQMASALSLVDIEEFEHTLFRTPELYFGYYFAQNRNQ
    LGSEEGFQPEKTVVYEESDKIELHKFYPIGTWKNHEDSMELISEEGEIKLLYNAKEVNIVTANNAELEIYLDGEALPVQY
    SGNDIISGNTLSVSEPGLYNIITNEESASHVLELKVKGKGFQIFTFTFG

    >gi|161528337|ref|YP_001582163.1| DSBA oxidoreductase [Nitrosopumilus maritimus SCM1]
    MIHGPSLAIGAGISAVVLVIVFLGFDGISNESELVMQPTPTIQPEGPARVTMETFLANGSPILGDSNAPITLVEFGDYQC
    HFCNVFFHSTEGDILENYVETGKVRMIFKDYNIIGPDSINASHGAHCANDQGMFWEYHDILYNNWTGENNGWASSENLLR
    FAQEIGLDVDTWSECMIDRIHSKTIVASNEDARSLELTGTPAFFVIGPDGEVTSLFGAKPYSTFQMTFDSELEKLS

    >gi|161528389|ref|YP_001582215.1| DSBA oxidoreductase [Nitrosopumilus maritimus SCM1]
    MTKYYLLVIPIAIGIIAGGFLAFYPEPEKNPTKLTPSTLIENGSPILGNSNAPITILEWGDYQCTFCYKFHKDTLNVINE
    DFIKTGKVKLVFKDFPLNGPDSVLAGEASFCARDQGKYWEYHDELYKNWGGERTGWVTRESLDIFASTVGLDLQTFNECL
    DEHKYQNKVNALYEFGREIGIDATPSFLVFNDEKIIKIRGNQPLEVFLKTIDEL

    >gi|161528484|ref|YP_001582310.1| periplasmic binding protein [Nitrosopumilus maritimus SCM1]
    MTVNRIVSFLPSATELLYEFGVQNKVYGVTHECKYPSEAISKPQVISSVIDSEKLSSNEINTQTCQLLNEGKDIFILNEK
    NLKDANPDLIISQETCEV
    CAAYTNQVNKALQILERKPIIHSMDPHNISEIIESVIKLGKILEEESKAKEISESLEKRIQK
    IKNKVHTNIPKILAIEWIEPFFTAGHWVPEMIEIAGGKNTISKTGEHSRRMDFEEISNSDADIIILMPCGFDTKRTVSEY
    KDILERDEKWNMLKAVQNQAVFAVDANSFFSKPSIRTVEGIEILAKIIHPETFDDVNVSENSFANVYQ

    >gi|161528503|ref|YP_001582329.1| peptide methionine sulfoxide reductase [Nitrosopumilus maritimus SCM1]
    MKATFGAGCFWHVEDLLSKTKGVKSTQVGYIGGNLPNPTYEEVCTDRTGHAEAVEVEYDPNEISYEELLDVFWNNHNPTT
    LNRQGPDVGIQYRSAIFYHDEKQKEVAEKSKTQLDSSGKFNDPIVTEITPAPTFYKAEEYHQKYFKKNGF

    >gi|161528651|ref|YP_001582477.1| DSBA oxidoreductase [Nitrosopumilus maritimus SCM1]
    MKIQYFSLIVIAAGVITVGAIFSTTSNDSESINLDMNRKIGTVDTSLGSPILGSPNAPITIIEFGDYQCSNCKKWFLDTK
    PDIMTNYIDTGKVNLVFVDIAFLGKDSGPASVATYCAEEQGKYWEYHGFLYSNQMSIDNGWANSDSLKGYANNLGLNMEM
    FVSCLDSEKYSKRVQFNTDESKRNGVTGTPTFFVIGPNGEQEKIAGPQPYTVFEKTIESMT

    >gi|161528653|ref|YP_001582479.1| glutaredoxin [Nitrosopumilus maritimus SCM1]
    MEKIIVFVVPAVNGHLKIIQSNLKMNHKIEILTTPSCGNCKVVEAMLDEMNIKYTVIDVTEKPEYLEKYPIFTAPGVVID
    DKLVFTGIPKKHELLEKLSA

    >gi|161528656|ref|YP_001582482.1| DSBA oxidoreductase [Nitrosopumilus maritimus SCM1]
    MEDFEFIEDQKPDKEISVSKSTFNRLIVAIVAVSIVSAFLGGYVIGGETAEPKEVVIRESVPNLQPSTASQQQFGPQIIR
    NISFDDDPMKGNPNASITIVEFSDFQ
    CPFCAKFHETTLPLIEQNYIQTGKVNFVYRDFPIQNIHPNAVPAALASECADDQ
    GKFWEMHDMIFEDQQIWKDLPVAQSVTLYKQYASELGLDSIEFDSCLDSGKYIEEVQNDLNDGRTYGVSGTPGFFVGNAD
    IGFTPISGAQPYSTFQRVIDGQLNR

    >gi|161528658|ref|YP_001582484.1| DSBA oxidoreductase [Nitrosopumilus maritimus SCM1]
    MLVKTFVKNNLVLCVASVVLVVFFLGYLVGMEVGQDTVRKQELANLEQRLAELKDSKSNTPSQISKDNDPLLGDPDAPLS
    IVEFSNFQ
    CKFCLRFYSDTLPLLKTQYIDTGKVNLIYRDFPIPKIYDNSMSAALASECANEQGKFWEYHDILFENQHTWR
    QNESDLSLLTFKQFANTLVLNQEKFDSCLDSGKYADEINSDVGDGRDYAVSGTPTFFVGNDKVGYSSLFGTQSFSDFQKI
    IDEKLEQ

    >gi|161528689|ref|YP_001582515.1| DSBA oxidoreductase [Nitrosopumilus maritimus SCM1]
    MSFDDNEINQNEHTQNKSKSNGLIIGLIVAVGVAAFFAGMYFSNANSDQISQEDLDDAIAKLELKMLQNRLPTNQPSEPV
    KISADDDPIIGNPDAPITIIEFSDFQ
    CPFCARFHVQTLPLLLEEYIDQGKVKLVFRDFPIQSIHPNALPASVAAECANEQ
    GQFKAMHDMLFDNQGQWSNQETVDALSMFSQYATQIQLDQETFDSCLTSGKYIEEIRKDLDDGRSYDVTGTPGFFVGNDE
    IGYVELKGAQPFESFKKVIDAQLEA

    >gi|161528699|ref|YP_001582525.1| hypothetical protein Nmar_1191 [Nitrosopumilus maritimus SCM1]
    MTENNLIHETSPYLLQHAHNPVDWYGWNDEALKKAKDENKPIFLSIGYSSCHWCHVMAHESFENEEVAKFMNENFVNIKV
    DREERPDIDDIYQKACQIATGQGGWPLSIFLTPDQKPFYVGTYFPILDSYGRPGFGSICRQLSQAWKEKPKDIEKSADNF
    LDALNKTEKVSISSKLERTILDEAAMNLFQLGDSAYGGFGSAPKFPNAANVSFLFRYAKISGLSKFTEFGLKTLKKMANG
    GIFDQIGGGFHRYSTDAKWLVPHFEKMLYDNALIPVNYAEAFQITKDPFYLDVLKKTLDFVLREMTSPEGGFYSAYDADS
    EGVEGKFYVWKKSEIKEILGDDADIFCLFYDATDGGNWEGNNILCNNLNISTVAFNFGTTEEKVREILQACSKKLLDVRS
    KRVAPGLDDKILVSWNSLMITAFAKGYRVTNESRYLDAAKDCISFIENNLFSGDKLLRTYKNKTAKIDGYLEDYSYFVNC
    LLDVFEIEPDPKYLKLALKLGHHLVEHFWDSENNSFFMTSDNHEKLIIRPKSNYDLSLPSGNSVSAFVMLRLFHFSQEQQ
    FLDIATKIMESQAQMAAENPFGFGYLLNTISIYLEKPVEITIINTENSQLCDSILLEYLPNSIVVTIQNSTQLSALSEYP
    FFAGKSFEEKTSAFVCKNFTCSLPLHTIDEINSHL

    >gi|161528760|ref|YP_001582586.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Nitrosopumilus maritimus SCM1]
    MSAVIGEKVPNFGVSDWVQGAPTNFDQEKDHIVLVEVFQVNCPGCFMHALPEAIEIYNKYKDDGVRVIGIATAFEDFDKN
    TLDNLKMLAETGEIVGETKSAFQMSGQLQEGDKLPYKIPFPLAMDNLVKTTGEISQEKIMEFIYPQIPEFDSQPEDYRNQ
    IIQRVKDYMKSKEYSAETFEKFALRGTPSTILVDRKGVLRDVSFGQVGQAEAMIQKLLSED

    >gi|161528783|ref|YP_001582609.1| rhodanese domain-containing protein [Nitrosopumilus maritimus SCM1]
    MNKVIPVGIGIAVIVVIAMAAGFIGYEVEPTPSAIPIDQPFSISSSELEQQMTLDPNLVVIDMRNSNSYVDGHIAGSSVD
    VMEGATLDKRIKTMFGRIPEVTQNMHVVLVGDSQSSALNSAQIMNDAGIKTSFLVDGIQSWDENLSTKMTPTVTSSEELY
    EQLQNQDDVYLLDVREPSELEVTMISGSKNIPLADIFIEENLSEIPTDKPVVII
    CGSGNRATIATYELAQHGIDFQVLEG
    GIIAWDAYLDENNLPKH

    >gi|161528785|ref|YP_001582611.1| hypothetical protein Nmar_1277 [Nitrosopumilus maritimus SCM1]
    MKGYLKYSLSIPVFAAVFLLAVTALPAQEQPADAYARTVMVHITSDENHRVLMGVQHAKAMLDSGKNVAVLLDVDGVKAG
    VNQPDSNLSASNDLLQQFLADGGRVIA
    CQHCVGMAGFSMSDMLPGVEIDSHPNMPKMQRLIDSGAVILDY

    >gi|161528811|ref|YP_001582637.1| iron-sulfur cluster assembly accessory protein [Nitrosopumilus maritimus SCM1]
    MATEQTQKMITVTEKAAEKIKEFMKEEAESPEYLRVYVQGGGCSGLSYGMGFEKAPEEDDIVMEENGVKLLVDSYSVDHL
    QGANVDYIESLMGSGFKINNPNVTKSCSCGHSFSTE

    >gi|161528946|ref|YP_001582772.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Nitrosopumilus maritimus SCM1]
    MNDKLTKLPHDLPIPKNDGKASHLLGRQIPNLILPSTKNSFFDLSAIEKKYGILYFFPMMNMPEKDLPQGWNDIPGARGC
    TPQNISVTKHIIELEKHDAMPIGISSQPIADLEQLSTLRNFSQILVSDNKLEFQKKLNVPVFAVDGNTLYKRLTLIVKNS
    KIIKVFYPVFPPDEHIFEILKWLEKENEN

    >gi|161528965|ref|YP_001582791.1| methyltransferase type 11 [Nitrosopumilus maritimus SCM1]
    MPSFEDEMLDVMNKAAIALLLSVGHRTKLFDAMSKLEPSTSQEIATAANLNERYVREWLGGLVTSKIIDYDPESQKYSLS
    KEKAEFLTRDGEYNFASSMQWIPALAYVEDHIVDCFEKGGGVSYEMFNRFHTVMAEESQQTVLPALVKEILPLIPTYEKL
    HSGLKVLDVGCGSGRAINLMAKSFPNSHFTGYDFSSEAIQNAKNEAQKLGLSNVTFEKQDAANFDSENSFDVITAFDAIH
    DQANPDKVLENIKKALKPDGIFMMQDIRASSKLENNMNHSLAPYLYTVS
    CLHCMTVSLALEGKGLGAMWGKELATQMLNE
    AGFSSVDVKELPHDPINYYYIAKP

    >gi|161529004|ref|YP_001582830.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Nitrosopumilus maritimus SCM1]
    MVLLESQVKLKTGDTAPDFDLLGIDDKKHALGDYKDYKGYLVIFMCNHCPYVKAKVDALNELYEKCGSDVAMIAINSNDS
    TDYPEDSFDAMKETAKEKGFKFDYLVDETQEIAKKYGAMCTPDPYLFDGQKQLVFHGRIDNAMKPDDTATEKTMINNIDK
    LVTGQKIEKDFDPSIGCSIKWKEN

    >gi|161529056|ref|YP_001582882.1| UBA/THIF-type NAD/FAD binding protein [Nitrosopumilus maritimus SCM1]
    MANITFTIPSVLNHGGGEKKIEIPADSLQDVFTKISEQMGDDFKRRVLEGDGTPRSLINIYINGKNAKFSSGMETALKDG
    DEIYILPAVAGGSEELSPKELDKFSRQVMLEEIGYGGQLKLKNAKVCVVGTGGLGHPIISRLATMGVGNLRIIDRDVIEL
    SNLHRQIMFDEDDVGQVKVEVAAKKLQKLNPDCKIEALAVSINDYTALEVVEGCDVVIDALDSVNARYALNKACVKYNIP
    FVTGAAVGTSGQAFTVLPKESACYFCMFPELNEDTMPT
    CSIEGVHPPILSIVGAIEVAEAVKIILGKKPNLSERILHIDL
    ESLDFNSTRTFRADECPICGTGKLEVVQKEELILEELCGRNRGKRTYSITPTDTFELDVDAVTNIAKQKGFLVDNQGDLG
    LSMRTNDLSVSFMKKGSAVVVGPKDEDDAISLYNCLLGKEIKA

    >gi|161529166|ref|YP_001582992.1| DSBA oxidoreductase [Nitrosopumilus maritimus SCM1]
    MESKENVNKIIVKKSTFTSLVVVLVITIAISAFFAGNYVSNMNSDKVTQSDLNNAFAKLEEKIGTSTQPSIQPNTQPIKV
    SIDDDPMKGDPNAPITIIEFSDYE
    CPFCGKFYTDTLPLIEENYINTGKVNFVYRDFPIQSIHPNAVHTAMAAECADDQEM
    FWPYHDMIFENKSTWEKQRGQSLVSELVQYADVLGLDTEEFTTCLESNKHLDEVRNDLQDGQSYGISGTPGFFIGNDNSG
    YIKVSGAKPYQTFAEILEGMLRR

    >gi|161529178|ref|YP_001583004.1| DSBA oxidoreductase [Nitrosopumilus maritimus SCM1]
    MDIIDIVKNNKTTLIASIVLVIAIALYFTEIQAKNNSDLGETNSLDAKILPETEISKDDDPLLGNPDAPISIIEFSDYQC
    PFCARFYTQTLPTLESEYIEKGKVNFIYRDFPIQNHPNARPAALASECADEQEQFWEYHDILFKKQDMWKRLDLDTVTST
    FKEYAEELNLNQEMFDSCLDSEKYSDEVDSDFADGRSYKISGTPTFFIGNEETGYSSVFGAKSFYEFQEIIEEKLDKLEK


    >gi|161529205|ref|YP_001583031.1| rhodanese domain-containing protein [Nitrosopumilus maritimus SCM1]
    MLISTDELNSILGDPNLILADTRSFKEYSEGHIPGAVHLDLFAFHWIDTTKQGIDNFNNQSKSLLSFLGVAPEKKVIFYD
    SISGMLAARGVWMLMYFSHQNVMMLDGGITKWQKENLAVETKPNGFKPSDFSGKINSEIISGFEYIRDNLDNVKILDARS
    PGEYDGSTVRAAQSGHIPNAINIDWSQNLKEDGTFKSDEELSKMYDFPKDTEIVTY
    CQGAYRAANSFLVLKKLGFSNIKV
    YLGSWGEWGNRLDLPVEK

    >gi|161528648|ref|YP_001582474.1| protein-disulfide isomerase-like protein [Nitrosopumilus maritimus SCM1]
    MKLSKKIIIGAIIIAIIFLLHSLVSPEIDKKFTPENDSDTLSNNDFNSVPPSVSPVVGDPDAPVTIFAFNDYQCTSCKYW
    YDTNYSEISEKLVETNKANIVFLDVSPLGDDSILISQATFCADEQKKYSEYQEMLYVSQQEIDTWAKSDQLKNFALELDL
    DIDQFSNCLDSGKYGQDIQSNIDYTNSLGVEKIPLFKIVNFKGEEHVFKGGIPRVLFEEVVDRFQD