Natronomonas pharaonis DSM 2160 uid58435

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|76800674|ref|YP_325682.1| methionine sulfoxide reductase A [Natronomonas pharaonis DSM 2160]
    MTATATLGGGCFWCVEAAFEELDGVESVTSGYAGGHTEDPTYREVCSGNTGHAEVVQVAYDSDVLAYEDLLEVFFTVHDP
    TQLNRQGPDVGSQYRSIVLYHDDTQRELAEAYIESLDEAGEYDDDIVTEIERLETFYRAEENHQNYFEKNPQDAYCRMHA
    QPKIETVREAFAEKVDSR

    >gi|76800679|ref|YP_325687.1| peptide methionine sulfoxide reductase (R-form specific) [Natronomonas pharaonis DSM 2160]
    MSDTDGERNDIPDSDDEWRKRLSEEEYRILREAGTEPKFSGDYLDKGDDGVYRCAGCGATLFDSETKFDSNSGWPSFYAA
    EDDAVEFREDRSHGMVRTEVVCARCEGHLGHVFDDGPEPTGKRF
    CMNSVALDFDDGK

    >gi|76800681|ref|YP_325689.1| molybdenum cofactor biosynthesis protein MoeB [Natronomonas pharaonis DSM 2160]
    MTDLSLSADQLDRYSRHIIMDDVGPEGQKRLLDANVLCIGAGGLGSPIIQYLAAAGVGTLGIADDDVVERSNLQRQVIHG
    DDDVGQPKVESAAAFVEALNPDVTVEPHETRVTADNIDGLLAEYDVVVDGSDNFATRYLVNDACTLAGVPFAHGAILRFE
    GQITTFEATPEGPCYRCLFPEAPEPGTVPD
    CATAGVLGVLPGTVGCIQATEAVKLVLGHGETLDGRMLFYDAADMSFEEI
    PVEKRPDCPVCGDGGVESVHDVDYESTCAI

    >gi|76800687|ref|YP_325695.1| iron(III ABC transporter periplasmic substrate-binding protein ABC transporter periplasmic substrate-binding protein 2 [Natronomonas pharaonis DSM 2160]
    MPPTVVSLLPSATEIVAALGVDPAATSHECDYPPSVADTPTVVESRIDADADSETIDEQVHEAETDGGVYAIDRETLAAV
    DPDIVISQGICEV
    CAVDTVQVEAAIADLGLDCRLVTTDPHSVDDILGDIERIGAALGKDRRANRLAAALESRMDRVADRT
    AGRSRRPTVAVLDWLSPPMVAGHWVPELVERAGGEYGLADPGDASMPREWATIREYDPDVLVAAPCGFDLEQTADNRTDL
    TERPGWNDLRAVRNGRVYAMDGHHLTNRPGIRVLETLETLAALCAPTERDSPAPWMARPLAADG

    >gi|76800707|ref|YP_325715.1| dihydrolipoamide dehydrogenase [Natronomonas pharaonis DSM 2160]
    MVVGDISTGTELLVVGGGPGGYVAAIRAGQLDVDVTLVEADAYGGTCLNEGCIPSKALIHVATLADEVESAEAMGLHARA
    DVDMQGLVDWKDGVVDQLTSGVEKLCKANGVSLVEGRAEFVDGETARIAHGGEGQGSETVTFDSAVIATGSRPIELPGVE
    FDGEHILDSSDVLDLRSVPESMTVVGGGYIGMELSTMLAKLGCDVTIVEMLDDILPGYTEDITRLVRNRAESLGVAFSFG
    ERATGWEPAGDGVRLDTETEDGETASYTAENVLVAVGREGAADTCNVEALGLEPRNDGTLETDATTQTSVDGIYAVGDVA
    GEPMLAHKAYREGHVAAEVVAGEPSRLDYQAIPSAVFTDPEIGTVGLTEAEAEAEGFDPVVGEMPLRASGRALTLGADEG
    FVRIVADAETGFVLGGQIVGPEAAELVAEVGLAIELGARLEDIAATVHTHPTLSEAVAEAAANARDSAIHTLNR

    >gi|76800784|ref|YP_325792.1| transport ATPase 2 ( substrates zinc/cadmium) [Natronomonas pharaonis DSM 2160]
    MDCSSCAGKVESALTDAVGVERVETRPTSGVVVVEYDDSATDVPSLVATVEAAGYEVVDTEGRMTGGADVWRSRRATLTG
    LGAVAMALGFLSLWGPLADPTLATVGRETTLSDVAFLVSGAVAGTPIVRAGLRSARLRELDIDLLMGAAIIAAVVADHYV
    EAATLAVLFSTAELLEAHAMDRTRESIRELLALSPETATVKRADGDEETVPAASVGVGQTVVVRPGERIPVDGVVADGAS
    AVDESPITGESVPVDKDDGDEVYAGSVAEGGYLEIEATAPGDETTLSRVIELVEQAESRRTEAEQFVDRFAGYYTPVVVV
    LAVLTFLVPPLAFGWPWDTWFVRGLTLLVIACPCAFVISTPVTVVSGLTSAARNGVLVKGGDHLERMGEVDTVAFDKTGT
    LTTGELSVTDIVPAAGYERQDVLTTAAAVEQYSEHPIGEAVVEYADEQDVGYPSATAFENLTGRGVRGDLDETYYVGKPG
    LFADLGHDLGHAHLRSDGGVSAAAGVADCDRPGCVDLRTETIAELQDEGKTVVIVGTETELVGVVAVADTVRPEAGRVIE
    ALSDAGVRTVMLTGDNERTARAVGDTVGIEDVQAELLPEEKLDAIEDLLAAGTVAMVGDGVNDAPALARADVGIAMGAAG
    TDAALETADIALMADDLNGVPYCLRLSRTANGVIKQNIVASLGVKALLAAGVPFGYVSVIIAVLVGDMGMSLGVTGNAFR
    LGRIDPEERD

    >gi|76800849|ref|YP_325857.1| homolog 2 to thiosulfate sulfurtransferase [Natronomonas pharaonis DSM 2160]
    MDGEISAETLQELLDSDTDLRIVDIRSPAQFGRGHIPGSDNIPFQELTTHIEQVADADRVVTVCPHGQASQQAARLIASF
    EGFDGRVDSLEPGIEGWPYDLETDEGSETEASDAPF

    >gi|76801141|ref|YP_326149.1| thiosulfate sulfurtransferase / hydrolase ( hydroxyacylglutathione hydrolase ) 1 [Natronomonas pharaonis DSM 2160]
    MDPEAMDFPTPDATVESTTPRELKERIDAGEPVTLLDARMESDYEEWRIDGDTVESINIPYFEFLDEDIDDDVLASVPDD
    EHVTVL
    CAKGGASEYVAGALADRGYDVDHLADGMNGWASIYEPHEVTGYDGAGTLLQYQRPSSGCLGYFLYHDGEAAVID
    PLRAFTDRYLDDADELGVELRYAFDTHVHADHVSGLRDLAAEGVEAVLPGPAADRGVTYTDEVTLTQDGDTFPVGEATIE
    TVFTPGHTTGMTSYLVDEGFLATGDGLFIESVARPDLEEGDEGAPDAARTLYQSLQERVRTLPDETLIGGAHFSDAAAPA
    SDGTYTATLGALDSRMDALSMDEDEFVDLVLSDMPPRPANYEDIIETNLGQREIDDEEAFTLELGPNNCAASQDALTGD

    >gi|76801142|ref|YP_326150.1| hypothetical protein NP0982A [Natronomonas pharaonis DSM 2160]
    MIAAFLGSGAVESLFPNGISRYAVGGVLVGLGTALIYAGTGIPAGASTFLESTLSYVSEQSRFQQYRPSRDWRVVFTGGI
    VAGAAIYALTFQSGFVTSSLYTPGTTGQLHDVGGFAAWTTDVSPWRLFVGGVLVGVGTRIGKG
    CTSGHGICGVGSVSRTS
    LIGVVTFLVVAILTANAVSALGVGI

    >gi|76801277|ref|YP_326285.1| glutaredoxin [Natronomonas pharaonis DSM 2160]
    MANITLYELAGCPYCKKVIDKLDELGLDYDSIEVPRSHSDRTEVEDVSGQTGVPVIIDEEHGIEGMPESDDIVEYLEETY
    GS

    >gi|76801306|ref|YP_326314.1| thioredoxin [Natronomonas pharaonis DSM 2160]
    MSVTLKDFYADWCGPCKTQDPILEDLEADYPDVDFEKVDVDAAQDVANEYQVRSLPTLIVENDDGIVERFVGVTQRDDLE
    DALDEAGA

    >gi|76801345|ref|YP_326353.1| thioredoxin reductase [Natronomonas pharaonis DSM 2160]
    MTDHYEVTVVGGGPAGLTTALYTTRLGHDTAVINRGGGRAAMMLDTHNVIGITEDTSGNELLSRATEQIQEYGADYHRGT
    VTDIQSTDEGFAVTAGDTEVTTEHVVLATGFSDKRPDPPLPRTGKGLHY
    CLHCDAYMFVDEPVYVMGTSESAAHVAMIML
    NFTPDVDLLTRGEDPEWSDETDTQLRNHPVEVVHEDITGLEKDDDGWLSAFEFEDGTVREYRGGFPMYGSEYNTDLAESL
    GVELNDDGTIGVDDHGRTNVDGVYAVGDVTPGHNQIPVAMGEGARCGIGNHYDLRAFPRSLDDIESEGPVTEADVPAVSE
    KLKEAATTHEGHPGAGEAAGDD

    >gi|76801359|ref|YP_326367.1| glutaredoxin [Natronomonas pharaonis DSM 2160]
    MSEPDITLYRLQACPFCERVVAVLDELGLAYRSRFVEARHSRRDVVKRLTGARTVPALVDDRTGVTMSESANIVEYLRAT
    YGDGGGGAE

    >gi|76801375|ref|YP_326383.1| thioredoxin [Natronomonas pharaonis DSM 2160]
    MDAAVVRHLDDERDFEAFVTSHEVVLVEFYTTGCPKCAAMEPVLGTVARATGVPVGLCDLGSVPVVERFDIASTPTLILF
    TNGDPADRLAEGFVGADRLVEFVDAVQE

    >gi|76801453|ref|YP_326461.1| thioredoxin 2 [Natronomonas pharaonis DSM 2160]
    MRRRDVLIGAGSLAVLGGGAAVAFDAVGSDSGTYVDPVDLETLDAPGSEAGTTTVPDPGRVTFVELFAKWCGICEDMMPA
    LAEASAAVEGVQFVSVTNEALGTTTTREDVIEWWRDHDGAWPVAVDADLALTQRLDATGVPYAFVIDAENRVSWQHRGAS
    DAEEIIAQIRAVQG

    >gi|76801671|ref|YP_326679.1| ferredoxin-NAD+ reductase 1 [Natronomonas pharaonis DSM 2160]
    MSTFVVIGGDAAGMSAASKAKRDTPDLDVVVFEKGAWVSYGACGLPYYIKGEIQTLEDLVSVTPEQFREERDIDLRTGHE
    VVDIDPDDRTVTARGDGEELVQPYDSLLIATGAAAVVPDIEGVDREGAYTLGSMTDGKELREFVARAREEGPAEQPDSGP
    ACQQLENCNGPVGVVGGGYIGIEMAEALAANDFEVHLFQRSDRVLKAFAPETSAAVADHLESQSVSLYLGSEVQALDGDD
    GVEAIVTGDGERVPVEMALLGAGVRPRTDLAAAAGIELGPTGAIATDAYRETNIDDVYAAGDCAEAEHVVTGEPTYVPLA
    LTANRHGRAIGQTVAGTPTKGGGVAGTAAVKAFEMEAARTGLSHDDAAAAGFEPVTETIEAKSRAGYYPGGGTVTVTLTA
    DSETGRLLGGTLHSEYGEGAVHRSHGLVGAVTEGVTLSELSNYDFAYAPPFNTTWDPILTAAKVLDGTL

    >gi|76801678|ref|YP_326686.1| glutaredoxin-like protein [Natronomonas pharaonis DSM 2160]
    MTFDPNADAADPENVQERVDTLIEDNEVVLFMKGNELMPQCGYSKKALQLLTKYRDDVVTEDVLDALDAYRAALESHSGW
    ETIPQTFVDGEFIGGSDILEELDNRGELHDELGVDADDVDADDAGTDDAGAEAPF

    >gi|76801903|ref|YP_326911.1| hypothetical protein NP2520A [Natronomonas pharaonis DSM 2160]
    MTFRDGTLVDWHAWGEEPFARADREKTPILCSLTAPWCDWCHRMDEEVYSDPKLAANIGESFIPVRVNVDEHPRVRERYN
    MGGFPTTVFLTPDGEVLSGATYLGRDGFRQVLDSVRESWDAKGGAAGRVPRSLSDDDRPAGEVTAAIEAHMVEQVAASFD
    DEFGGWGTGAKFPLPRTVSFALKRDRERATRTLEAIRTHLLDTYDGGFYRFAETRSWGEPHREKLVDENAALVSTFAHGY
    LYTGEEAYLQSAERTVDYLTTTAWAGEAFAGSQAASDYYTLEPTERENAEPPHVDETVFADRNGMAAEALFEIAALTDDD
    SPARYAERALDHVLETLVDDGHVSHFADDASETGLLADHARLLAGLTTAAQVTGPDGWLEPARAIADDAIDRLKTADGSF
    RDGDPTGAGLLGRPLYPLETNAEFADALLDLWGLTGDDRYMTAATDAIAAFAGAYERMGVEVAQYATAAARAHYDPVVVR
    TPPAGSDLHRAALRIADHEKVVVPEDRETAVVVRSGETSAPAEAPDELLDRAASGPAP

    >gi|76801910|ref|YP_326918.1| disulfide bond formation protein [Natronomonas pharaonis DSM 2160]
    MSPDLTRRGYLAVTAAAGGAALAGCSDDVTADPDAIDDADRPALGAENAPVTVTVFEDYGCPACARFKAQALPALIDQYI
    ETGEVRYLHADFPIPVDEAWSHPVANAAREVFFEAGNDAFWLFSSSIYDHQGSYSLDAIETVAADVADDEAVGAAARAAA
    DEEAHSERIAADRDRGESWGVGGTPAVFVDETEVDPAYDEIDSAIQDRL

    >gi|76801928|ref|YP_326936.1| hypothetical protein NP2572A [Natronomonas pharaonis DSM 2160]
    MSQSVDTDPVEVTEDAAEQAISLIENEGYDTDEAGLRLFVQQGGCAGLSYGLRFDDAPEDDDAITEHHGLRVFIDPSSQN
    YIEGSVLDFEGGLQGKGFSVENPNVESECGCGESFRT

    >gi|76801976|ref|YP_326984.1| transport ATPase 1 ( substrates copper/metal cation) [Natronomonas pharaonis DSM 2160]
    MATETRIEVGGMHCSTCSETVAESVEALDGVRSASVNYATDSATVEYDPGTASLSDIYGAISEAGYEPRRETRTIEVGGM
    H
    CSTCSETVAGALAEVPGAIDASVNYATDEATVEYNPEAFSVETARAAIEDAGYDPVVDESDDDGDAGGSAAERELRKQR
    RLVVGGGLLTLPFIYLMTAMFSPLPQPDTVAGVPFGWVEFVFATALMATLGKEFIVGAYTAARNRTANMDTLVAVGTTAG
    YLFSTAVVLGAITGDLYFEAVGFILWFITVGNWLEARSKARASDALRELLRMEAEEATVVVDGEERTVPLSEVAVGDRLK
    VRPGERIPTDGVVVDGDSAVDESMLTGESVPVEKSPGDEVVGSTVNENGVLVVEATKVGEDTALQQIVRRVKEAQSRQPD
    IQRLVDRVSGYFVPAVIVNAVVWAILWAAFPTELYSLVQYLPFEQVGGGPVAGGVPLFEFSMVVFASAVLIACPCALGLA
    TPAATMVGSTISAKNGVLFKGGDILERVREVDAVVFDKTGTLTEGEMQLTDVVPLDSHRPDGGAVTTPAVDETYVLSAAA
    SAEAGSEHPLGQAIVAGAKERAIDVTEPTEFENVPGKGVTATTDHGEVLVGNRKLLEDRGVDTAPASETMAELEAEGKTA
    MVVAVDGAVVGVVATADTVRESATETVAALTERGYDVFMLTGDNERTAHAVAAEVGIPEANVRASVLPDEKADVIDAIQA
    DGTHAMMVGDGVNDAPALTTANIGVAIGSGTDVAIEAADVTLMRSDPADVLKALRISQATISKVWQNLFWAFAYNTTLIP
    IASLGLLNPALAGAAMAASSVSVMTNSLAFANYEPTSDYVPLPLRPLAALR

    >gi|76801982|ref|YP_326990.1| thioredoxin reductase [Natronomonas pharaonis DSM 2160]
    MTDDADHRRLIIAGSGIAGLTAAIYAARSNNDPLVLEGPEPGGQLTLTTDVANYPGFPDGIGGPDLVNNMKEQAEQFGAT
    IDHGVIDAVDPGQPHRIELRDGTVYTADALIAASGASARTLGVPGEDELMGYGVST
    CATCDGAFFRGEDMLVVGGGDAAC
    EEAAFLTKFADTVYLAHRREEFRAEDYWVDRIRELEADGDVEVLTNTELVEIHGTPEDGVDHVTLAHNPDGYPSEKLDDD
    ATETTERDLGAVFMAIGHTPNTEYLEGTGVEMDATGYIHTQGGEGGGQTKTDVSGIFGAGDVVDHHYQQAITAGGMGCKA
    AIDADEYLEALEREEGAVADADAAAASDD

    >gi|76802026|ref|YP_327034.1| hypothetical protein NP2768A [Natronomonas pharaonis DSM 2160]
    MSDIETTTINEEKYHAFSRAGEFELSIDASGNDGPSPNEVLVADYASCFTFACRAGAKRRLEVDLGKVETEAEADLDDSD
    DIEAIRFHLFIEAALTDEQLESVIELGEEI
    CHVHAVLDSAVHADVEATANAF

    >gi|76802092|ref|YP_327100.1| peroxiredoxin-like protein [Natronomonas pharaonis DSM 2160]
    MVAEGDDAPDFTAPVRTSDGNISEFTLSEALADGPVVLAFFPGAFTSVCTGEMTTLRDRLDDIEAGGASLYGVSIDSPFS
    LGEFAEQNDLEFPLIGDTNKEVIDAYDVVMDFEDLGIEGVAKRSVFVVDEDGTVTYSWVSDDPGVEPDYDELEAAANDA

    >gi|76802127|ref|YP_327135.1| transport ATPase 4 ( substrates copper/metal cation) [Natronomonas pharaonis DSM 2160]
    MSDPDFDFDSDPALDTDDTCRLCDLPLPASPVAGADTEGEFCCRGCLEVQRSLGDLDQEAAAAVRNRVGGDAPDESDDRG
    EAAFFAVDGMH
    CTTCEAFLEGRAEALDGVYSVEASYATDTVRVNYDPEAVDESALPEQLSGYGYEAGERADGRHGDETNA
    VAKFLAGGGFFGMMVMMWYVLFLYPTYFGYDPVVDLDGYVGLYVFANIWLMTSFVLFYTGWPIIRGAYVSLRAGAPNMDL
    LVTLAACSAYAYSTLAMLVGRTDLYFDVSVAVILVVTAGGYYESRIKQRAVGLLSELTEQQVDKARRENGETVPVSEVAA
    GDRLLVRPGERVPLDAEVVEGSAAVDESLITGESHPVTKRPGDGVAGGTVVTDAPLVVAVDEGAESTLDRLVELLWSIQS
    RSPGVQRLADRLATIFVPLVIVVATVITAWMLVAGNPVTAALLVGLTVLIVSCPCALGLATPLAIASGVGAATERGIVVA
    TETVFEEAADIETVVLDKTGTLTQGSMAVTDVHADDAEPVVERAAAVEALSEHPIAEAIVEYDAAGDMAADGGVVEESPT
    DSGSDRSADAAIADADGFERHSRGVVAPVDDETVVVGHPDLLRHNGLSVEERYSDHIEATRANGDVPVAVGWGGRCRGVI
    VVGDTPRPEWREAVESLSRNRSVVVLTGDEGAAADRFRSVDGVDEVFAGVPPEAKAETVRRLRGDGSVAMVGDGSNDAPA
    LAAADLGIALASGTKLATDAADAVIVRDDLHAIEETFHIAERTNSRIRQNLGWAFVYNGLAIPMAVTGVLNPLLAAAAMA
    LSSTLVVSNSVRSLVDYE

    >gi|76802210|ref|YP_327218.1| transport ATPase 3 ( substrates copper/metal cation) [Natronomonas pharaonis DSM 2160]
    MGTCTLCELPTPDTPVTEADVDGEFCCRGCLEVYRSLGDVDVEDVDEEALGTDTTPADDVPESAETAYLSVEGLHCATCE
    LFIESVADDIDGVYAAEASYSTDMARVHYDPDTCDPSSLPDALSQFGYYATEPGEEPDSFLDRLSFKEYRSVIALLVMMP
    VMAPYLLFVYPTYLGIYPRSFLFESNLYYMVFVPLFVWSTIIVAGVGYPYFRGAYVSLRVRQPNMDVLIALAVSAAYLYS
    TVSVFLLGSRTVYFDVAVMILAVVTVGDHVESRVKERALDYYSELAESRVTHARLLDDDGATQEVPLESCGPGDRVLVRP
    GERVPVDGTVVEGTAAVDESVITGESVPVPKSPGSEVIGGSIVTDNAVVVEVGDEGTSTLDRLVELLWSVQSSDAGIQRL
    ANRFALVFVPVVIVIAVVTTLGWVALGRPVGEAILIGVSVLVVSCPCSLGIATPLALTAGTNAASSSGMLVFDGSVFERI
    PDTDTVAFDKTGTLTTGEMAVVDVVGDDPDAVLRRAAAVEQRSSHPVGKAILAAAPETTATVTAFERNPRSVAADVDGDR
    VLVGHPDTFDAEGWTVPERFRTAVDETRADGKHPTVVGWNGTVTGVVALQDTPRDDWQEAVAALGAETDVVVITGDDERV
    ARQFEAEPAVDEVFAEVRPEAKRELITRLQADGEVTMVGDGTNDAAALASADLGVAMAHGTELTIDAADAVVTGDELATV
    PEFFDIADRVRRRIRQNLVWAVGYNVVAIPLAVAGLVNPLIAAVLMAASSLIVVSNSRRSLV

    >gi|76802233|ref|YP_327241.1| thiosulfate sulfurtransferase [Natronomonas pharaonis DSM 2160]
    MTEHDSPTLVSADWVEEHLEDFQSDDPEYRLLEVNNPTVTADSEYTPYEEGHIPGAIFFDWDDDLSDETTRDILDKDAFE
    ELNAEAGITEESTIVLYGGGRVPNWFALFAYWQYRYFGHDDVRIIDGGKPYWVENDYPLTADEQAFAAQEYEASGPYESI
    RAYKSDVEQAIDSGIPLVDVRSPEEFTGEVIAPEGLQETAQRGGHIPGAKSVPTTSVLDDDGTFKGPDELRELYEDVGIT
    EDQSVITY
    CRVGERSSIEWYVLAELLGFDDVQNYDGSWTEWGNTIRAPIETGDAE

    >gi|76802339|ref|YP_327347.1| hypothetical protein NP3402A [Natronomonas pharaonis DSM 2160]
    MTDDAMGNFPVPELSDLPEDIKERIESETERAGFTPNVFSAFAYKPSHFRAFFEYHDAIVDESPLEREEIEMLIVTVSGV
    NDCLY
    CVVAHGALLRVYADAPKLAEQLATNHRSADLSEPHRAMLDFAVTLTETPGKVDERDLERLREAGFSTEEIWDIGS
    VVALFNLSNRMATLADIRPNEEFYTLGR

    >gi|76802392|ref|YP_327400.1| NADH dehydrogenase [Natronomonas pharaonis DSM 2160]
    MTDDVVVLGSGYAGTGAINSLESELDGEADITWISDVDHHLVLHESHRCIRDPDIQEKITFDVTEIKSPSTRFVQGRVED
    IDTDERVITLDDDSTVEYDYLLVGIGSQTAFFGIDGLEEHSLTLKTLDDALEIHEAVSEAAREASRNDPAQVIVGGAGLS
    GIQSAGEIAEYRDSNRAPLEIHLVEGLDNVFPNNDPVVQAKLRKLLEDKDVQIHTGEFIGEVDDDTVYVGDEKELDYDVL
    LWTGGITGQDAAETANVDKDDRSNRIEAASNFQTSDERVFAIGDAALIDQPDQDNPAPPTAQAAWQAAEVAGENIAREIR
    GQPLTEWEYEDKGTLISVGGKAVAHNVKGLPVDTFGGPAAKALKKTVAARWIAKVTGFSDAAKAFPDM

    >gi|76802488|ref|YP_327496.1| thioredoxin [Natronomonas pharaonis DSM 2160]
    MSRAATPDEPVSVEGPGHLEERLDEHETVLVDFYADWCGPCKMLAPKLSAVAAETDAAVLKVDIDANQALASEYQVQGVP
    TLYLFHNGDVEDRMVGMQDEATLKQKIAAVQ

    >gi|76802514|ref|YP_327522.1| glutaredoxin [Natronomonas pharaonis DSM 2160]
    MTLTLYRLEGCPYCEFVVDTLEDLPLDFESVWVEGLHSKRNEVHEITGQRQVPALVDDAHGVSMSQSARIIEYLETTYGD
    ATSPDEVELDF

    >gi|76802592|ref|YP_327600.1| thioredoxin 1 [Natronomonas pharaonis DSM 2160]
    MQRRTVLGGLAGAATLAVGGWAARRGPTAGDSVGNAAGDEDGDGSGGVPAQIETIDAPGSEAGSLVLEEEYPLVVTFFAT
    W
    CSSCSREMSDLTAAHAEVGDQVPFLSLTGEVVGRSVSRAEVADWWREHDGAWSLGLDPDSQVMNQFSVIGIPSVVLVDA
    DGEVVWSDSGHVDTDALVAEAATVADNA

    >gi|76802617|ref|YP_327625.1| hypothetical protein NP3966A [Natronomonas pharaonis DSM 2160]
    MENRLDEASSPYLRQHADNPVAWQPWDETALETAAERDVPIFLSIGYAACHWCHVMADESFDDPDTADVLNEHFVPIKVD
    REERPDVDNVYMQVCQMVRGSGGWPLSVWLTPEGKPFHVGTYFPPEPTKNTPGFKSVLEDIAEAWDDTERRQQLEQQADQ
    WATSISSELEDTPEPVAEPPGEEFLDTAANAAVGNADREHGGWGRGQKFPHPGRIHLLLCAYQQTDRETYRDVAVETLDA
    MASGGLYDHVGGGFHRYCVDREWTVPHFEKMLYDNAEIPRAFLAGYQVTGDDRYAEIVAETFAFVDRELTHPDGGFYSTL
    DAESEDSTGTREEGAFYVWTPEVVAAAVDNETDAELFCERYGVTDAGNFENATTVLTESRPPEELAAERVMDTATVEERI
    ERAREQLFESRAERSRPPRDEKVLAGWNGLMISALAEGALVLDPEYADDAAAALSFCREQLWDETEEVLNRRFEGGTVGI
    DGYLQDYAFLGRGALDLYQATGDVEQLSFALSLGRVIQSEFYDADAGTLYFTAEGGDSLLARPQQLADSSTPSSTGVAVE
    LLSRLAAFDPDAGFDDVAETVIETHASTLESNPLSHTSLVAAAHDSAAGRIELTVAAADLPETWRTSLAETYLPGRLLSR
    RPPTDDGLDPWLAALDVDDVPPIWANRDAKDGEPTVYACRSFTCSPPKHDIDEAIEWL

    >gi|76802636|ref|YP_330731.1| ferredoxin--nitrite reductase 3 [Natronomonas pharaonis DSM 2160]
    MTLDIDTIAPEALADEREQYTIVDVREPRDYRELGHIPGAANVPFERIRDRSTDAAGRLPTPATVRQQLSAAGVEQGDPL
    VAYDNSRGVEAARFLLTAAVYGHDGPLYLLEGDFDVWQHDNETERGPGPEGSSEYGAVALDEDAIVNRATVEAAIDADEG
    AVLVDTRTAGEYESAHLPGAVHLGWEAFVDAETDRLKPESELRTLLESRGLSSDDEILLY
    CNTARRLSHTYAVLSSLGYD
    EVRFYEGELTGLVRANSPAWDPQELYHSVRAVAPEGFDALPAELGDDIFSRLHLLGLYTTRQDGYFMLRTKIPGGQLTAE
    QARTVGRVADEFATAPPEHGGSEQNPVFGDGFLDVTTRQGIQMHWIRIEDMPEIWDRFESVGLTTIQASGNTLRNVVICP
    AAGVGHETVDVRGLAEDVADAFEGSTRYANLPRKFKVSLSGCHENCGRAELQDLGFVPAVKDGRDGFAVKVGGGLSDGPR
    AATDLGVFVPPERVVDLSLAAADLFIDHGAYLDTAVNRLKYIVDRWGTDRFREELESYVEFEFEPYDELLTTEYRGDHVG
    IHEQADGNHTVGLNLPTGRICGDELQTLADIAERYGSGEVRTTANQNLVVPGVRGEVLESMLGEPLLSSYSPDPGPFSRG
    IVTCTGREFCKYGVIETKSRGYRWAKELDAWLDDADIPESAVPEAVRIHMSGCSASCAQPQIGDIGLRGEAYRDETQAAQ
    AVDVGLGGDLDRDQFVDWVSGRIPVGEVPTAVKRVLRRFVETRRDGETFAEWADRTDTERLDRIVTTSTHPQEAD

    >gi|76802694|ref|YP_330789.1| thioredoxin [Natronomonas pharaonis DSM 2160]
    MSSESASTSPSEPIPIEETNGLDAVTSEYDTVLVDFYADWCGPCQMMEPAVESVAESTDAAVIKVDVDANQDLAAEFGVQ
    GVPTLVVFVDGEVAEQVVGAQSEDRLRELVDR

    >gi|76802711|ref|YP_330806.1| hypothetical protein NP4154A [Natronomonas pharaonis DSM 2160]
    MALESASDELDVGDPAPAFELPGVDGDQHSLDDFGGYDALLVVFMCNHCPYVQAKFETMNRLADDYDDLAVVGINPNDAD
    EYPEDSFETMVEYADRGDIDITAYLRDEPQSTAEAYGAVCTPDPFLFHNDGGAFRLVYHGRFDDALAPDDEPSEAPGFEM
    RAAIEAVLNGAEPEPAPGPSRGCSIKWLE

    >gi|76802784|ref|YP_330879.1| transport ATPase 5 ( substrates copper/metal cation) [Natronomonas pharaonis DSM 2160]
    MDECSLCDLPTPDPPVADDGVDGTFCCRGCLEVARTLDDVDAESVPVDGSTDETTAVSVPDDAAETFVAIDGMHCTTCEA
    FLGIRADAVDGVYSIEANYATETARVRYDPDRIDEADLPERLSGYGYTARFRSPAETDDGPATRQQHETVERLVIGGFLS
    MLIMPWYLFYLYPSYVGIETGLLDIDTTTPIGIYLPLSIIGLLTTIVLFYVGFPVLRGAWTSIRARRPNMDLLVSVAALS
    AYGYSTVALATGSTHLYYDVSVAVVMVVTLGRYYEGRIRSRATDLLSSVTAIRVSEATRLTDDGRETVSVDDIEPGDRLV
    VAPGERVPVDGTVIEGIADVDESVLTGESLPVTKRPGDNVIGGAVVADDALVVAVGPEAESTVDRIATTLWEIQSSRPGV
    QRLADRLATVFVPVVLSLGTVVTAWQLLSGEPVAAALLAGLTVLVVSCPCAMGLATPLAVAGGLRDALQDGLIVANESVF
    ELAPDADTVVFDKTGTLTAGTMEVTDVYGHEATLRRAAAVECLSDHPVADALLDAASESADPVATDGGTVTTDTTGGTHP
    TAANRPLPDVEAFTRHPGAGVSGTVDGTRVVVGTADLVADRVGPLSETLAARVDEIDAAGGRPVVVGWDGTARGVVAVAD
    RERAAWSEALDAVADRHVAILTGDESADTDRFADHPAVDQVFAGVPPDGKVETVRRFAADGTTVMVGDGTNDAPALAAAD
    LGVAMSSGTARAVDAGDAVITDGDLTTLEDVFDVADGTRRRIRENICWAFLYNAVAIPLAVVGLINPLFAAVAMAASSII
    VVSNSRRPVVGE

    >gi|76802896|ref|YP_330991.1| disulfide bond formation protein [Natronomonas pharaonis DSM 2160]
    MRRRLLAVGTLVAAVATLGSLYFSDVAGFVPCDLCWYQRILMYPLVVVFGVAAVESRVGVWRTALPLSGLGVVVSAYHTA
    IQLTPETT
    CTVGGGCTAIYWRGLGVFTIPRLALVAFLLLAALSVALAVVERRVDG