Natrialba magadii ATCC 43099 uid46245

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|289579717|ref|YP_003478183.1| iron-sulfur cluster assembly accessory protein [Natrialba magadii ATCC 43099]
    MSTDSMDGGQAETRPEIEITESAAEQALSLLDSEGMDANEAGLRLFVQQGGCAGLSYGMRFDDAPDEDDTIYEHHDLRVF
    VDPASLKYIEGSILDYESGLQAEGFHVENPNVVSECGCGESFRT

    >gi|289579722|ref|YP_003478188.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Natrialba magadii ATCC 43099]
    MIDEGTPTAFDVVVVGGGPAGLSTALYCTRLGNRTALIDKGGGRAAMMQDVHNVVGIPEAMNGAKLLSTGKEQLEAYGCT
    VYQDTISSCSRSESDSTAETAEQEQRDTTDDSDSPPPKITLCGTDTDYVAEYVVVATGFTDVRPEPPLPWTGRGLHY
    CLH
    CDAYMFTDEPVYVMGTSESAAYVAAIMLNFTVDVDLLTRGEDPTWSGETDTMLSNHPIEIVHEEVTGVENGDDGWLDSMT
    FEDGTVREYTGGFAVYGSDYNNGLATELGCDLNDDGTVVVDEHGRTSVENVYAVGDLTPGHNQVPIALGEGAKAGISIHW
    DRREFPRDPGLIDELGTVRKEDVPGIPDELLERAVEYHTYN

    >gi|289579894|ref|YP_003478360.1| Heavy metal transport/detoxification protein [Natrialba magadii ATCC 43099]
    MEQTTLEVTGMSCGGCESNVIDAVEALEGVSSVTANHEADEVRVEHDEAAIDESTIADTIADAGYEPAV

    >gi|289580032|ref|YP_003478498.1| peptide methionine sulfoxide reductase [Natrialba magadii ATCC 43099]
    MTHPDEEFTRQSPDAAGALQPPPETQTATFGMGCFWGPDARFGAMEGVVRTRVGYAGGTEPNPSYYSLGDHTEVVQLEYD
    PETLSYEDLLEVFWANHSWQPPSRKRQYRGVVLAHDDEQYEAAHRTKDDLAERTGTTVESEIEVLESITLAEDYHQKYEL
    RSTPVAGDELVDQYGDEFVDSTVVARLNGFVAGHGTEEQRRCVLAELDVPATVVAELRRRF

    >gi|289580092|ref|YP_003478558.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Natrialba magadii ATCC 43099]
    MLDVGDDAPAFELSNQHGEAVRLADFDGQRLVIYFYPRANTEGCTTEACQFDDALAAFEDANTAVVGISDDPVSDLDSFA
    DEYDLSFDLLSDEDGTVATQYDSYGEKQMFGNTFDGVFRNTYVVGPDGTIETVYENVSPDGHAERVLESLEGEEST

    >gi|289580361|ref|YP_003478827.1| glutaredoxin-like protein [Natrialba magadii ATCC 43099]
    MDFPPNQGLDQEEVTEQVEETIADNDVVLFMKGTELMPQCGYSRRALGLISEHREDFETVDVLESLDEYRVALNEHSGWE
    TIPQTYVDGEFVGGSDILAELEERGELAETLNSA

    >gi|289580464|ref|YP_003478930.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Natrialba magadii ATCC 43099]
    MSDQPRVEIYTKTNCPYCDKAKDLFDSKGIEYDVYNVTGDDELFEEMVERADGRKTAPEVFIDDELIGGWDDTSALEETG
    ELDEKLGIADDVGNDGHGGGDGDGDGDGDDGGEDTIEHRPLIIAGTGIAGLTAAIYAGRSNNDPLVIEGDEPGGQLTLTT
    DVANYPGFPDGISGPELVNNMKEQAKQFGADLKNGIIDTVEADQRPFRVELTNGDVYTADAVIAASGASARTLGVPGEDE
    LMGYGLST
    CATCDGAFFRGEDMLVVGGGDAAMEEATFLTKFADTVYIAHRREEFRAEDYWIDRVHEKVEEGEIEIMKNTE
    LVEVHGSQEAGVDHVTLVENDQGHPTDRLDDPETNEFEFDVGAVFLAIGHTPNTEYLEGTGVTMDDEGYLRTQGGDGGGQ
    TETDVPGIFGAGDVVDYHYQQAVTAAGMGSKAALDVDEYLDDLERAEATSETEAAAADD

    >gi|289580473|ref|YP_003478939.1| electron transport protein SCO1/SenC [Natrialba magadii ATCC 43099]
    MNRRRALTVGVTTGLTAVAGCLTGMLDDESSEHAVLAPPEEDIQSESLYPTYGDPFPAFELEDPIGETTVDVSALEDALV
    VTAFFASCPDE
    CVPLMNSISQVQTNAAERGLGDETRILAITFDPERDTGDALQDHSDTFGINYEADNWHYLRPEDHEMAQ
    SVVYDDLGIPFEREELGDEYDFMHITVTFLVNPNGYVERAYRGDDPDPVRITDDLEQVLDGHE

    >gi|289580559|ref|YP_003479025.1| OsmC family protein [Natrialba magadii ATCC 43099]
    MSKQATTISEEGFSATNEIRDFETTIDSNGEEGPDTLETLLAAYGSCYVPALRVGGQQRGVDELGKIQIDTDGELNDDDK
    LESISFDIQVEADVDDETGEEILERAFEL
    CKVHDALKDSLHADASIDGDAF

    >gi|289580675|ref|YP_003479141.1| Rhodanese domain protein [Natrialba magadii ATCC 43099]
    MSDYDTDVLVSADWVEDHLNEFQAAESEYRLVEVNSPESPDKGDFPSRYDEGHIPGAVRMQWDEDLSDQDQRDILKKDDF
    EATVGEHGISEDSTVVFYGNGWIPNWFALFAYWEFKYYGHDDARVLDGGKDYWVNEEYPLTEDEPNFDAVEYTAKGPFES
    IRAYKDDVDKAREAGIPMVDVRSPAEFSGEIIAPEGLQETAQRGGHIPGASNVPVKTNLRDDGRFKEPDELEELYADEGI
    DGDESVVTY
    CRVGERSAIAWFALHELLEYDDVHNYDGSWTEWGNLVRAPIERGESG

    >gi|289580687|ref|YP_003479153.1| methionine-R-sulfoxide reductase [Natrialba magadii ATCC 43099]
    MGNDDHERATASEQQSPVDKTDAEWRAELDEEEYRILREAGTEAPFSGEYVDHKADGSYECAGCGAELFDGDTKYDSGCG
    WPSFYDVDDDRIETRLDTSHGMQRTEVLCANCGGHLGHVFEDGPEPTGKRY
    CINSVALDFEDEETED

    >gi|289580726|ref|YP_003479192.1| Rhodanese domain protein [Natrialba magadii ATCC 43099]
    MPEAISAAELRDRIEADNLDVLFDTRAPEDYEDWRIAEAENVEYSGSDDELVGDFDPEAYDTNDEIVVTCATGRSAGKFA
    AYLDEVEGFENVAHVEGGMEDWSLVYDVVPIATTRDDLELLQLQRRAKGCLGYLIGSKRTGKAALVDVTRATDAFEDAAA
    ERGYEIDRVFDTHIHADHISAGRGLAEKYGVPYHLGEPANTRDPQFEFDPIEPNETVEVGDVSIKAVHTPGHTTGMTAYL
    VEDEALLTGDTLFVESIGRTELQFAGEDAKSGARVQYETLQHKIATMPDHVKILPGHFSLTNCGEYIDVEPGMPMFSTVG
    EIWAKNEIIQLEEDEFVEHMFDNLPSKPPNYEKVIKTNLGVYEPDDEDERNELELGPNRCAATEDSAVADD

    >gi|289580727|ref|YP_003479193.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Natrialba magadii ATCC 43099]
    MHTGFDYDVAVVGGGPAGLTSALYTTRLALDTVVIDRGGGRAAMMQETHNVIGITEAVSGNELLQTAREQVQGYGADVER
    GFVESVTPLGEAADDGFRVETDAESYRVSRVVLATGFADKRPDPPLPPTGRGLHY
    CLLCDAFMFVDEPVYVMGAGEAGAH
    VAMILLNFTDDVDLLTRGEDPSWSDETATMLEYHPVDVVTAEITGMNKNDDGWLESFEFEDGQVRAYSGGFPMYGSDYHD
    EVVEGLDIERTEDGSVAVDDHGQTSVDGVYAVGDLTPGYSQIPVAMGEGAIAGITIHKELRAFPRSLEEFETEGSVTDAD
    VPALSAELATTAVEHDGHAHSPDDPDTK

    >gi|289580729|ref|YP_003479195.1| Peroxiredoxin [Natrialba magadii ATCC 43099]
    MTDESDESGFPLIGDQFPELEVETTHGPKSIPDDYEGKWFILFSHPGDFTPVCTTEFVGFEQRREAFEELNTELIGLSID
    RVHSHIKWTEWIDEEIDEKIDFPIIADESGDVADALGMVHPGQGSSTVRAVFIVDPDGITRQVLYYPKEIGRNVDEVLRS
    LEALQTSDQEGVALPANWPENENFGDKVLLSPPGTVDEAEARTAEADEEGYESYDWWFTLKELES

    >gi|289580732|ref|YP_003479198.1| transcriptional regulator, MarR family [Natrialba magadii ATCC 43099]
    MAETQPDEALDDLPPSSKFIYKTLADNGPMTLKGLTEETMLSSRTARYGLDQLEEAELLDSSPALHDGRQTCYKLTGTSA
    GAGDESDSTVLVSPEWVEERLQEFKRDDPSLRLVEADGEYDDGHVPGAVQIDVLADLVDVDGCGIADRRCFEEYLGNRGI
    TDESTIVVYSTHQNQYAAYLFWLLKYYRHTEVRLLDGGKHRWEEIGGPMTTDEPDVSQQTYEAPTPNEQIRAYRTDVEAA
    LAQNVTIVDVRSELEYEGDRTKPPDKVLPEARVGGHIPGTVHITWSEVIDENSRFKDRSELERLFHHHGVDPDTETIVY
    C
    HVGERSSIVWFVLSELIGYDTVSNYDGSWIEWGNLIDVPVETETDE

    >gi|289580855|ref|YP_003479321.1| glutaredoxin [Natrialba magadii ATCC 43099]
    MADITLYNLPGCPFCVKVQSKLDELELEYDVINVERDHAKRTEVEAVSGQTGVPVITDEATDVEGMHESDDIVAYLEEMY
    GA

    >gi|289580874|ref|YP_003479340.1| Methyltransferase type 11 [Natrialba magadii ATCC 43099]
    MAYKLDERELEEKVTTLYQAVATEPDEEYHFEMGRPLAEQLGYPTADLDRIPERALASFAGVGYHIDMAGLRAGDSVLDL
    GSGSGTDAFVAALHVGDEGRVVGIDMTDEQLEGARAARDAAGMDTVSFERGYIEELPFGDDSFDVVLSNGVINLSAQKER
    VFEEVERVLAPNGRLALSDIVSREHMPERIKNDVDLWAS
    CIGGAMQLDDYTDVIERPGIDIVVMRANPQYEFTSERAQGA
    CQRYGVRSISIGARVNPHR

    >gi|289581069|ref|YP_003479535.1| UBA/THIF-type NAD/FAD binding protein [Natrialba magadii ATCC 43099]
    MSDLRLDATQLDRYSRHVIMDEIGPEGQQRLLEGRILVVGAGGLGAPAIQYLAAAGVGRLGIVDDDVVERSNLQRQIVHR
    DEDVGRPKVESAADYVSALNPDIDVDAHETRLTADNVDELVSDYDLVLDASDNFATRYLLNDHCVLTETPLCHGAIYRFE
    GQVTTFTNERGGDAERPCYRCLFPEAPEPGTVPD
    CATTGVLGVLPGTVGCIQATEAVKYLLGKGDLLEGRLLLYDAMDMT
    FETVDVRPNPACPVCGDEPAIESVEDVSYDGTCQISAD

    >gi|289581104|ref|YP_003479570.1| Rhodanese domain protein [Natrialba magadii ATCC 43099]
    MVTTLSADRLAELQDEGESFALVDTRPEDSYEAWHVPDAINFPFDPEEELDENGQLESFKETVGDTDQVITICAKGISSG
    NFATQLESATDEYEVQTVDGGMEGWSGVYDHVDLSDEIAADGLTVIQLQRRAKGCLGYLVGCGETGEAVVVDPTADIDEF
    EIAAGDAGLSIVGVIDTHVHADHISGGRELADSLDVPYYLGTRAKERGVELEFTGLERNEVLEVGSLEIKALATPGHTSE
    MITLLVDAAALLTADTLHVDSTGRTELEFGQDSEAQHASGESNGETVREGEEGARMLYETLHRTILAEPERLAVLPGHVT
    VTAEGEFEHGSPGEPILTTVRAARTGINLLDLDEEAFVERMADAGEKPANYEEIIDNNRGELDLPPEERVELEMGPNNCS
    A

    >gi|289581205|ref|YP_003479671.1| hypothetical protein Nmag_1533 [Natrialba magadii ATCC 43099]
    MQIVTTLPSATELVVALGLEPAGVSHECDWPPRVESGPSITRSRIDTDGSSSEIDQQVLDVVEDAHSESETAGDDDETGD
    TPGVYDIDTDTPGVYDIDTDTLAALDPDLVITQGMCDV
    CAVDDIAIADALESIPANPELLTTDPHSMADVLSDLERIGRA
    TGREERAAEVRAELESRVDRVRERTRDCTPQERPRVAIFDWTDPVMIAGHWTAELVEWTGGEYGLADVGERSRPREWDEI
    REYDPECLVVAPCGFGLEQTAANIGELTEREGWDELTAVQEERVWVMDGNHYLNRPGPRLVDTLEALAPVIRPDLFGDSS
    DPATADELVVSLDALEKNIETDRAAAGRQP

    >gi|289581235|ref|YP_003479701.1| Thioredoxin domain protein [Natrialba magadii ATCC 43099]
    MRRAWQLALNRMTVTLKDFYADWCGPCKTQDPILEELENDWDGRFEVEKVNVDEQQDVANEYQVRSLPTLIIENDDGIVE
    RFVGVTQREDLEDALESAGA

    >gi|289581262|ref|YP_003479728.1| Rhodanese domain protein [Natrialba magadii ATCC 43099]
    MDGEISPDEVKELLESDADVRIVDIRDQHSFNHSRIPGSENVPFQKLTSRVEEFEDASRIVTVCPHGKASIQAAQLLGSY
    EGTADARIESMEGGLEKYGLKFGLVAGDREAESGAADGEHSADAGAGSESPF

    >gi|289581337|ref|YP_003479803.1| dihydrolipoamide dehydrogenase [Natrialba magadii ATCC 43099]
    MVVGDVTTGTDVLVIGAGPAGYVAAIRAGQLDLDVTLVEKDAYGGTCLNHGCIPSKALITATDVAHDARNAEAMGIHADP
    AIDLAGMVSWKDDVVDQLTGGVEKLCKANGVNLMEGMATFADENTVRISHDGEGQGSETLEFEHAIVATGSRPIEIPNFS
    YGDEPILNSRQALSLDSVPDSLVVVGAGYIGMELASVFAKLGTDVTVVEMLDEILPGYDDDLKRPVKQHAKGLGIEFEFG
    YTAAEWHEREDGDGVRVVAEPAPEVAADGGAAAEEAEEADTLDLDAEKVLVAVGRQPVSDTLDLGEAGVETNDKGFIETD
    SRARTNVEHIFAVGDVAGEPMLAHKGSMEGEVAAEVIAGEPSAIDYQAMPAVVFTDPEIATVGMSETDAEDAGFDTVVGK
    FPFRASGRALTTGESDGFVKIVAEEEEGYVLGASIVGPEASELVGELGLAIELGATLEDVASTVHAHPTLSESVMEAAEN
    ALGHAIHTLNR

    >gi|289581375|ref|YP_003479841.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Natrialba magadii ATCC 43099]
    MPLETGDDAPDVTAPNQDGETVSPAFDDPTVLYFYPRDDTPGCTTEATQFQRERDTYREAGVDVYGVSTDDVDSHQSFAE
    AEGLEFDLLADPDGAVAAAFEVDVEDGAVARTTFLLADGEVQAVYESVDPDGHARDVLLDAMDEGLVTLPE

    >gi|289581384|ref|YP_003479850.1| glutaredoxin [Natrialba magadii ATCC 43099]
    MSDTTSDVGDTTTGHEAPITFYRLQACPYCERVARLLEAYELEYQSRFVEPLHSKRDVVKRVAGVRTVPVIVDEQTGVTM
    AESANIVDYLESTYGSGDSSSSETETGAAAGGDD

    >gi|289581474|ref|YP_003479940.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Natrialba magadii ATCC 43099]
    MTGFDAGERTDGSSERTTCTTAAADGGIDEYDLVVLGGGSGSQVATAAVDEGHTAAVVEPGPLGGACVTRGCIPSKALIH
    RADIVDELHRAAEFGVHADLQEIEFGEFTAAIHDTVYEKADNQESSLDDTDGLTRYHGTGRFVDDRTIVVESDDENASQS
    DSSTPSQIRGDTIIIAVGGRPVIPPIGGVEDVDYLTSEDALFLDEQPDSLVIVGGGYIGAELGYFFGALGTEVSLVGRSE
    QLVPREDDDVSEVVTDALESHCELYTGYEAAAVEETDDGIVVTAEPSDDGGSGDEGDDSGENDNEENSDESVELEAERLL
    FATGRRPNTDSLDLEKTGVETDDSGHIEVDEQLATTADDIWALGDVLANEPYKHAADYETRIVTANVLDDAGEEVDYHAM
    PHAIFTSPQVASVGQTEGALEERGLEYQSANIPFGTAPLGMILDADGFVKVLASPEGEILGCHIVGPHASTLIQEVVTAM
    DSGSGMVEDVAEPVHVHPALSEVVYAAFDELSSREYSTAPDWRDVSGA

    >gi|289581477|ref|YP_003479943.1| Rhodanese domain protein [Natrialba magadii ATCC 43099]
    MDESVVVSPDWLAANRDRPDIRPVDVRDAWEFDAIGHVPGAASIPFDSYRDDSDADRGTLPGADAFASLLSAAGIGPGDT
    LVAYDDTHGVFAARLYLTALEYGHDDVRLLNGDYSAWSREYETTTAATEFEATNYEPHPLDREESPLVGREAVEAARERD
    ALLVDTRERDEFAEAHLPGAVRFDWREAVDDETRRLLSEGDLEGLLESHGITRDQDIVLY
    CNTARRISHTYVVLRALGYE
    DVAVYEGSLTEWIAMDGEIETGAS

    >gi|289581478|ref|YP_003479944.1| Rhodanese domain protein [Natrialba magadii ATCC 43099]
    MNSKNQGIAMASNEYANDVLVTADWVADRLDEFESDDPAYRLVEVDVDTEAYEEEHAPGAVGFNWETQLQDQTRRDVLEQ
    DDLEDLLGSHGISEDSTIVLYGDNANWFAAYTYWQLKYYGHDEVYLLDGGREYWLENEYPTTDEEPDFSAVEYDAAGPRE
    NIRAYREDVEKAIERGVPLVDVRSPEEYSGEILAPPGLQETAQRGGHIPGAKNISWAAVTTDDGTFKSREELESLYAEEG
    ITGGETTVAY
    CRIGERSSVAWFALHELLGYEDTVNYDGSWTEWGNLVNAPVETGDGS

    >gi|289581506|ref|YP_003479972.1| periplasmic binding protein [Natrialba magadii ATCC 43099]
    MNHNVISTSPSSTEILYALGVEPVAVSHACDFPPEAADLPTIDASKVDAEASADRHEQVRAATANGHLYQMDAERIDDAD
    PDLIVTQGVCGV
    CAVDDVLVDETLADLDADPEVLALDASRLEDVLECIHDVGRVTGTEARADELVTGLRERIATLEERVP
    AAPRPRMAVLEWMDPARPAGTWVPDIVELAGGEYGLSEPGERSAPVEWDSFLAYDPEVLVVAPCGFDAERTREQFGELSE
    RPGWEELTAVREDRVFILDGGAYLTRWTPRLVDAAERLATLCHPDEFGEPPADVVRL

    >gi|289581525|ref|YP_003479991.1| copper-translocating P-type ATPase [Natrialba magadii ATCC 43099]
    MTTRRTHLEITGMSCSTCSGAVEDAVAALDGVEAGNANYATDEGTVEYDPAETSLAEIYDAIEDAGYEAASITETLTVMG
    MS
    CSTCSGAVSDAVEGLPGVIRADVNFASDEARVEYNPNDISLADIHDTIEDAGYEPVRDEVEETQGASQRERAVEKELR
    RQRRLVIGGGILTLPFVPIMLAMFDLVTLPHLGTVDLAIATVPIMGLLEFVLATALMATLGKEFIAGAWRAFSHNRRANM
    DTLVALGTSAGYIYSTAFLFGLIAGAGLYFEAVAFILWFITLGNWLEVRSKARAGNALRELLEMEADEATIVEDGEEKQV
    PLETVAVGDVMKVRPGERIPTDGEVVDGQSAVDESMLTGESVPVEKEVGDEVVGSTINENGVLLVEATKVGSETAIQQLV
    DRVKEAQSRQPEIQRLVDKVSAYFVPAVIVNAVVWALLWAAFPGPLAAFVDAIPLLGLVQGGPEVAAAAAGGAGVPVLEF
    SVIVLASSLLIACPCALGLATPAATMVGSTLSATNGVLFKGGDVLEQVRGIDTIVFDKTGTLTHGEMTLTDIEIIDADES
    TVTDGGEPAPDGGTLAEQAETDADDSPEAFLLGAAATAESGSEHPIARAVVDGADERDIALGEVSEFENVPGHGVSAETD
    RGRVLIGRRKLLEDEGIDTQPAEATLTELEREGKTAMAVAVDGQLRGVLAVADEVRESAKETVAALHDRGTETVMLTGDN
    ERTAQAVAEQVGIPSENVRAEVLPEDKADHVEALQDEGNRVMMVGDGVNDAPALTTAQVGVAIGSGTDVAIESADVTLMR
    DDPADVLKAVRISEATISKVRQNLFWAFIYNTTLIPIAALGMLNPALAGLAMATSSVSVMANSLSFATYDPHEDYRLAVL
    KPFDALLGRN

    >gi|289581628|ref|YP_003480094.1| Rhodanese domain protein [Natrialba magadii ATCC 43099]
    MKRRTLLRATGGAVLGGSVGLAGCLDQFSDSESDNTDSHDFPPEYETETFNGQTVPFAPLEDVAEWWEDDEAYFVDTRTQ
    PQYDEAHIEGAVFSPAPDGLESSDPVSDWGTDTRIVTYCV
    CPIAQAGQRAAVLLDNGYTDVYGLADGFNPWRENGHPVES
    NDGQASLSTYEIEGETDPADAGEYALAVHPDTGQREASRIDANGGYELSLHFVDVPDSSLLELRTPSYELEGTIEEFSSA
    TVRA

    >gi|289582005|ref|YP_003480471.1| methylated-DNA/protein-cysteine methyltransferase [Natrialba magadii ATCC 43099]
    MNVALLDTELEFDESVVAESPAEIRDQVQEYERGDRRTFDLDVTYLDGLTGDVMAAMVAIPYGETRTYGDLAADLDTSPV
    AVGQACGRNPAPIVVP
    CHRVVGSDGALTGYSAADGVVTKRRLLEFEARESGRAVQTELPVEFE

    >gi|289582068|ref|YP_003480534.1| disulfide bond formation protein [Natrialba magadii ATCC 43099]
    MNQTRRAFLGTTGTVGLGVVAGCLGSEDPPEPPVAGNPDADVTVAVYEDFSCPFCRDFKLGVLPELEEQYLESGDVRYEH
    RDFPIPVDDTWSWALPSAAREVFESEGNDAFWEFTSEIYTYLGSYNYGAIEGVADEIGADGAAIRDAAEEESHRSTIEDD
    KSYGESNGVGGTPTILVDGDAVELYESEDFEAMALEETTAAIDAALE

    >gi|289582118|ref|YP_003480584.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Natrialba magadii ATCC 43099]
    MRRRDLIAGVGSLGVLAGAGGVLWRGIPVGDEPPAADAGGDEDTEDDDSDGPIVLETIDATGSEEGTIEVPNDGVTVVMF
    FSPS
    CGSCQALMPNLREASDQLNEEYGDDVTIVSVTSNRSEDELREWWDEHDGNWYLGHDPGRTLGVTYQVVGYPVIIVI
    DENGEKHWDENGVINPRQIYYGAAPVIDEYRERTEAADDADDAEEEPSGTDSEGEESDDEGSDEEGSDSEGSDGEDSEGE
    ATDEDDESGDSAENEENEDVEEAETDD

    >gi|289582188|ref|YP_003480654.1| uncharacterized peroxidase-related enzyme [Natrialba magadii ATCC 43099]
    MSDQDDTVDTDTDSDSDTDTDTDSGSVNDATGESNATPTLADDAMANFPVPDFGELPEDLQERITEETESAGFTPNVFSA
    FAYKPSHFRAFFQYHDALVEDTALEREEIEMIVVAVSGVNHCYY
    CNVAHGALVRIYAQDPQLADQLIANYRTADINETHR
    TMLDVAVTLTERPMAVEESDLDRLRDAGFSEEALWDIAAVTSFYNLSNRMAMFAEMRPNDEFHTLGRD

    >gi|289582304|ref|YP_003480770.1| Rhodanese domain protein [Natrialba magadii ATCC 43099]
    MDKINPAELDDRLSNGTAPYVLDIRPRKTYQRSHIDGSQNVPVYNDLRRGDDDELRQSLSQIPADETVVTVCKAGVVARK
    ATTVLEEEGYEAATLAGGMRRWNGYQNGSLGYRLSSLVRRVLP

    >gi|289582317|ref|YP_003480783.1| alkylhydroperoxidase like protein, AhpD family [Natrialba magadii ATCC 43099]
    MATPETQAEIEQILGQVPSWMETIAAPASDHSWGIFRDLTLGETELSPREKGLIGVGVAAAISCPYCTHFHREEARLADV
    SEDELEEAVSLASSTRYFSTTLHGNEIDMDEFVAETAETVDHLKEQEAAPAGAD

    >gi|289582504|ref|YP_003480970.1| protein of unknown function DUF255 [Natrialba magadii ATCC 43099]
    MGIGMGSDRDDGTRVEWREWGQEAFDEAAEAGCPILLSLTATWCDHCHEMDEETYAEPRIAANVNDSFVPVRVDVDRRPR
    VRDRYNMGGFPSTVFLAPDGSVLTGAGYLGHDGMRQVLDSVRTMWDTKGSGAGRVPRPLREDNPPAGELTSAVESAMLGQ
    LSEVYDQTAGGWGQQPKFPLPDALEFALKRDREMALRSFDAVSANLLDEYDGGFYRFATDSDWSGLQHEKLLDSNGALVR
    AFANAYLLTGKDEYREPAARTIEFLTTTLWNDAVDAFANSQPPGETDAHSLDATDREAAAEPPVDDIVLAGPNALAIEGL
    LTYAAYTDDERARRYATRALETLQTELIDEGVVTHAHPDTVADDAGATAPLLANQARTLSALTTAASVLDPAVLSTATAV
    ADATIDQLRDGDSFVDGPAAGAGLLDQPLRPLDSNVALADALLDLAALTGDDAYRTVAREVLESFAGASDRFGVQIAQYA
    TATSRLLEGPLVIAVADEPGTDLHRAALRMADHEKVVVPGADAVESAPEVEPGTARVLRGDRSSTVAETPTELSEAVQSV
    LD

    >gi|289582594|ref|YP_003481060.1| glutaredoxin [Natrialba magadii ATCC 43099]
    MVTLYRLEGCPFCEIIVDELEELDVAFESVWVEGLHSKRNEVKRVSGQRQVPVVVDDEYGVTMAESERILEYLESTYA

    >gi|289582639|ref|YP_003481105.1| protein of unknown function DUF255 [Natrialba magadii ATCC 43099]
    MTTSTPTDRNRLDEEESPYLRQHADNPVNWQPWDEQALETAREHDVPIFLSIGYSACHWCHVMEDESFADEQVAEVLNEN
    FVPIKVDREERPDVDSIYMTVCQLVTGRGGWPLSAWLTPEGKPFYVGTYFPKNAKRGQPGFLDILENVTNSWEGDRDEVE
    NRAEQWTDAAKDRLEETPDSVSASQPPSSDVLEAAANASLRSADRQFGGFGSDGPKFPQPSRLRVLARAAARTGRDDFQD
    VFVETLDAMAAGGLYDHVGGGFHRYCVDRDWTVPHFEKMLYDNAAIPRAFLVGYQQTGDERYAEVVAETLTFVERELTHE
    EGGFFSTLDAQSEDPDTGEREEGSFYVWTPDEVHDVLENETDADLFCDRYDITESGNFEGSNQPNRVASVSDLAAEYDLD
    ATDVRERLESAREKLFAAREQRPRPNRDEKVLAGWNGLMIATCAEAALVLGGGEDGDEYATMAVDALEFVRDRLWDEDEQ
    RLSRRYKDEDVAIDGYLEDYAFLARGALGCYEATGEVDHLAFALDLARVIEDEFWDADRGTLYFTPESGESLVTRPQELG
    DQSTPSAAGVAVETLLALEGFVDQGDEFEEIATTVLETHANRIETNSLEHATLCLAADRLESGALEITVAADDLPDEWRE
    AFAGRYLPDRLFARRPATDDELESWLDELDLADAPPIWAGREASDGEPTLYVCRDRTCSPPTHDVSEALEWLAGEEQTES
    PF

    >gi|289582641|ref|YP_003481107.1| hypothetical protein Nmag_2993 [Natrialba magadii ATCC 43099]
    MSLETMQPNPAWDAASYEDAVDTLEVHNDEVVYKVWGGDWCKDCRKLLPDFGAALDAASVPDDRIEEIAVDQDKQGSGVD
    EYGIEYIPTIVVETDDGEEVTRFVEEEAVPPAIWLADQLESEL

    >gi|289582706|ref|YP_003481172.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Natrialba magadii ATCC 43099]
    MQRRDVLAGIGSAGVLAGAGAVAVYGVPSPETLLGEDGERHEPLPIETVEAQGSEAGEVLIPAQDQPTFIDLFGTWCPPC
    VEQMPELAVANERIGDQVLFISVTSEGVGENRSITEDELVDWWAEHDGNWLLGVDHNAEMTERYLDGGFPTAAVIDASGR
    LQWSDSGVHSADEIVATIEEETDVEESP

    >gi|289582725|ref|YP_003481191.1| peptide methionine sulfoxide reductase [Natrialba magadii ATCC 43099]
    MERATFGGGCFWCVEAAFKALDGIESVTSGYAGGHTENPTYEAVCSGETGHAEVVQLEYEPDQIAYEDLLEVFFTIHNPT
    TKDREGPDIGSQYRSAIYAHDEDQLETAEAFAAALEDEGLYEGIVTEIEPLETFYEAEEYHQDYFEKNPNDAYCSMHAAP
    KVEKVREQFGSDATATQ

    >gi|289582762|ref|YP_003481228.1| cadmium-translocating P-type ATPase [Natrialba magadii ATCC 43099]
    MRDSTPGVPPDSADSAGSTDATDANQCADDCCSDENSSTTRTLELRIPEMDCPSCAGKVTNSVERLEGIDDLNAQVTSGR
    LLVSYDETATRESEIRDRVRAAGYEIVGERSGSDAGADGTAGTAGTASAGEHSFSVPEMD
    CASCASKVENALESADGVSK
    IETQPTSGRVTVSTDGDTDTATVVAAIESAGYDATPIDDGSNRMGDKQAVWKSRRAVGTALGGVLVTVGMVLEFVLPALD
    PALGTVAGRTYELSHLLFIAAVVVAGTPIIRNGYYSARNRSLDIDFLMTAGILASVAAHHPFEGAMLAVLFSVAELLERF
    SMDRARDSLRELMDLSPETATVRREDGTEETVPAGELEVGDVVVVRPGEKLPADGVIVEGESAIDQSPITGESVPVDKTA
    GDEVFAGTILESGYLEVDVESEASESTIARIVRIVEDAEREQTKREQFVDRFASAYTPIVVVLALAVAVAPPLVAGASWN
    TWFLRGLTLLVIACPCAFVISTPVSVVSGITSAARNGVLIKGGRHLEATGESDVLAVDKTGTLTQGDLSVTDVIPLEGAT
    EEDVLRRAGAVERRSEHPIGQSVVGYAEEQGVAVDEPDVSAFEALTGKGVRADLDGETHYVGKPGLFDGLADLEHVHATT
    DGGINVDGSTSPQGQRERQCEHENCLDVLEDVVPELEAEGKTIVIVGTEDGPIGVIAVADQVRPEAAWAVSQLQEQGVRV
    VMLTGDNEGTARAIATEVGIDEFHAELLPEEKLEWIERLEREAGGGEDGVIGGDGTGHVAMVGDGINDAPAMATATVGIA
    MGAAGTDTALETADVALMGDDLTRLPYLYELSGKANGVIRQNIWSSLAVKAVLAAGAPVGIVTVIHAVVIGDMGMSLGVT
    GNAMRLANVEPETPADAEFESVAGSADAVAPADSVDSATEANAVAE

    >gi|289582781|ref|YP_003481247.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Natrialba magadii ATCC 43099]
    MPATGDSAPDFTAPLANGDVDEFSLSDALSEDAPIVLAFFPAAFTGVCTDEMCTFQDRLAAFEDVDATVYGVSRDSPFTL
    NEFRAQNDLDFGLISDFNKEIIETYDVEMDFEDLGVYGVAKRSVFVVDSDGVITYSWVSDDPGVEPEYAEVEDAVEAAA

    >gi|289583029|ref|YP_003481495.1| Thioredoxin domain protein [Natrialba magadii ATCC 43099]
    MDDQTSTPTPTPIPVHLDDGDALESFVASHGTCLVEFYTKGCSLCQAMESVLGNVARSTGVSVGMMNPRDDPELIERFGV
    RSVPKFVVFHDGEQVASRADGFLGGDELTAFLETHAPAMDERA

    >gi|289583172|ref|YP_003481638.1| Redoxin domain protein [Natrialba magadii ATCC 43099]
    MAKESETELAAGDTAPAFELEGTDGETYTLESFADNEALLLVFTCNHCPYAKAKFDLLNDLAAEYDDVAVVGINPNDAEE
    YPDDSFERMQELVDDGTIQYDAYLRDASQDVAEAYGATCTPDPFLFRRDGDGTAADDDGADEFALAYQGRLDDALNPDEE
    PTRFHIREAIESVLAGEDVALEWEPSRGCSIKWAET

    >gi|289583331|ref|YP_003481741.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Natrialba magadii ATCC 43099]
    MRTDTGAETESEAESTSRSEAASSAESEPQTVDFLVIGSGSGLDVASVAANRGHSVAVVEKGPLGGTCLNRGCIPSKKLL
    YHADVMTTIERADEFGIHAAVTDVEFAEIVRDVNDDVSGSADSIEHGIRSSSQHTLLEGEGRFVDDRTVELVSGPDSGAR
    VRGETVLIAAGTRPAIPSLEGIDDVDYLTSTEALQLETPPDDLVIVGGGYIAAELAHFFGTFGSDVSIIGRRPQLLPQAD
    EEVGASFTDRYADRFDVYTGYEAVGVSQSGEGQSGDEITVNARPYPPAWGNPDERESLTVSGDTLLVAAGRQPNTDTLNL
    DATGVETDERGFVATDEYLRTTADGIWALGDIVGEYLLKHNANHEARTVARNLFGDELEPIDYTAMPFAVFSSPEVAGVG
    LREQDVREAERPYATATYQYEDTARGQAMHAEGVVKVLIEPSGEILGCHIVGPDAPTLIEEVVVAMTAGTGTVWDIRESV
    HVHPALSEVVDRAFSGQFVRRGPDGEGHQRQHGHGHDHGHGHDEERNHDHDHNHSH

    >gi|289583332|ref|YP_003481742.1| beta-lactamase domain protein [Natrialba magadii ATCC 43099]
    MSNTTIDPIDVSRRLQHDESADLFVLDVRSESEYDEWQIGESMNIPIYDELLEYDYSTLESHIDELPAETEIAVMCIAGV
    TSARAAEFLRTHGFDAKSVADGMNGWGRVHRQYEVESVDGVVQIVRPGTGCVSYLVHDDGEAVVVDPSQYIDEYLHVADE
    RELEIVGIADTHAHADHVSGARQLAGELDVPYYLHEDDAGELGRVTELVDGESIAVGGRDLDVIYTPGHTPGSVSFEFGD
    ALLSGDTLFLRSVGRPDLEDSAEDAVRTAASQLFDSLERVTELDDERVVLPGHFSDESIRPLATDLGELQAETTNELLSY
    VEAGDEDAFVETIVDSLADEPANYNEIKQINWGKEQPGGDVEELELGPNNCAAN

    >gi|289583340|ref|YP_003481750.1| thioredoxin [Natrialba magadii ATCC 43099]
    MMTTDTDSGSTPQSPTEPLYIDGKDHLDDVVTEHDVVLVDFFADWCGPCKMLEPVLDDLASATDATIAKVDVDQHQQLAG
    AYGVRGVPTLVLFADGEQVEQHTGALPADRLQTLVENYSE

    >gi|289583341|ref|YP_003481751.1| Thioredoxin-disulfide reductase [Natrialba magadii ATCC 43099]
    MSTDTPVTDDTVRDVVIVGSGVAGLSAAVYTARADLEPLVLEGPEPGGQLTLTTEVENYLGFPDGIGGMELIQNGKEQAT
    RFGAEFTHGTVETATLDEQPFALELASGETLRTRALIVATGASARWVGADGEDDLMGYGLST
    CATCDGAFHRGDDVLVIG
    GGDSAMEEALFLAKFADSVTVVHRRDELRASDIMAQRARDHDAIEFRWNTELLEIHGSQENGVTGATLVHHPDGHPTAKL
    DSSHEVDRETVDVGGIFYGVGHVPNTDFLAESPVELDDAGYIRTEPGMTTETAVEGVFGAGDVMDPDYRQAITAAGTGSM
    AALDAEAWLETRDVAETAAQPVVEVEAEAEAEVEAND

    >gi|289583396|ref|YP_003481806.1| Rhodanese domain protein [Natrialba magadii ATCC 43099]
    MDDMDFPTPDVEIESVAPAELKARIDANEDVTLLDARMESDYDEWKIDDENVESINVPYFNFLDEELDDDILAQIPDDQE
    VTVL
    CAKGGASEFVAGSLKEHGYDVNHLEDGMNGWARIYEAVEVEDYDGAGSLLQYQRPSSGCLGYFVHDGDEAAVIDPL
    RAFTDRYLADADELGVDLKYAIDTHIHADHISGVRTLAEDGVEGVIPSAAVDRGVTYADDVTVADDGDEFQVGDATIETV
    YTPGHTSGMTSYLIDGELLATGDGLFIESVARPDLEEGDEGAEDAAKQLYESLQERVLSLPDDTLIGGAHFSDSAVPADD
    DTYTAPIGQLESDMAALTMDEADFVELILSDMPPRPANYEDIIATNLGQQAADDEEAFELELGPNNCAASQESLAGD

    >gi|289583397|ref|YP_003481807.1| protein of unknown function DUF395 YeeE/YedE [Natrialba magadii ATCC 43099]
    MATELFAPALYESLFPAGISRYAIGGLLVGLGAVVIYLGTGIPAGASTFLESTLSYVSDQSRFQQYVSSRDWRVVFTLGI
    VAGAFVYALTFQSGLVSSGLYESGTTGQLYDLGGITLWLTDVQPWRLFLGGILVGIGTRIGKG
    CTSGHGVCGVGSASKTS
    IVGVITFLIVAIGTAQVVMALGVTP

    >gi|289583403|ref|YP_003481813.1| Redoxin domain protein [Natrialba magadii ATCC 43099]
    MRRRDVIAGVASLGVVGGGGLVAVRGLPSVDSDGATHSEGSDAEPADPITIETVAAPGSEAGEATIPADDRVTFVDFFGT
    W
    CPPCIEQMPALADTHDRIGEDVLFLSVTNEAVGSSITEAELVAWWDNHDGDWLLGLDPAAELTARYFAGGYPSAVTIDT
    DGHAQWSDSGVKTADELAAGIERALETERDA

    >gi|289583408|ref|YP_003481818.1| Thioredoxin domain protein [Natrialba magadii ATCC 43099]
    MNDNARATQGAETDENENRNGNGNGNENENEDRNTPETPIKLDDVADYDDLLDRHELVLLEFVTSGCGICASMEPVLGAV
    ARSAPGAVATVNAGYVPDLADEFGVRRVPTLVVLKDGDEVARLDDGFQSAETVVEVLETHAAA

    >gi|289583411|ref|YP_003481821.1| DSBA oxidoreductase [Natrialba magadii ATCC 43099]
    MPLNTPSRRAVLAGSVLALGGGSTYYLFQSRTDATHDLSPTLHASEDTSALGVDLAGKPTMGSPAAPLEIYYWTDFQCPY
    CEQFERETLPDLVADYTDSGDVRIVFIMLPLFGSDSMTAAVASRCVWEQIRESDPDSYWDWHAAVFDAQDERNSGWAGTD
    NLLEITESVPAVDADALATCLEQDRSRIEDAVEADAAQAQSFGIHSTPTFVVFDPETEAAGTLVGAQPNERFDDAIEQIR
    TA

    >gi|289583420|ref|YP_003481830.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Natrialba magadii ATCC 43099]
    MTDPFVVIGGDAAGMSAASKAKRDDPSREVIVFEKGSWVSYAACGMPYYVKGSVDELDDLVAMTPETFREERDIDLRTGH
    EVVSINRGEQTVTVATGDEQFEQPYGDLLIGTGAQAIVPPFDGFDRDGVFTLRGMDEADAIERYVDTQEPATAAIVGGGY
    VGIEMAEALTEHGIDVTIFEMLPRTLQPFGEEAARIVEGHLRDQGVDLQLETAVQGFSGGEAVDAVEVEGDEDPVPADIV
    IVGVGVAPNVELAEDAGIELGPTGAIATDEFGRTNDESVYAAGDCAEATNVVTGEPDHVPLALTANRAGRAIGATVAGEP
    AQIGKTAGTAIVKAFELGAARTGVLDAERAREAGFDPVSVTIDAPTRPHYYPGATELTVTLVADRESERVLGASIVGRKG
    TKRIDTVATALHASLTVTELQNLDLAYAPPFSPVWDPVLTAAKVLSGKLEG

    >gi|289583423|ref|YP_003481833.1| thioredoxin [Natrialba magadii ATCC 43099]
    MSDSLDDERERIREQKKRELQQRLENGGELRADESASGEPATPTEPIAIEGEAHLTDVVDTHDVVLVDCYADWCGPCQMI
    EPTIEALAAETDAAVAKVDVDQHQQLAQQLGARGVPTLILYADGEPVERMVGAQDRATLESLISQHG

    >gi|289583453|ref|YP_003481863.1| heavy metal translocating P-type ATPase [Natrialba magadii ATCC 43099]
    MTDQFPDHDSPSPDSVQAAGDSSSTRVSHAGDEDVPDEQPSGCTLCSLPLPSPPITASDAPGQFCCQGCLEVSRTLSTVE
    TDADESQIDPAAIRERIADSADSGEQGDEAQTDAESASAAEANDAFLTVEGMH
    CSTCEVFLESVAESNDGILAAEASYAT
    ETVRLAYDPETVESGELPELISGYGYAARERGTADDESDAANQALVKFLIGGGLFGMMVMVWYAVFLYPTYFGYDPVVDF
    GSYDGYYLAVNIWLMTTFVLFYTGYPILRGALVSLRAGHPNMDLLVTTAAVGSYSYSTLAMTLGRTDLYFDVTVAVILAV
    TAGTYYEERIKRRAAGLLSDLTEQQVDEARRVDGETVALESVEPGDHLLVRPGERVPLDGQLQEGTAAVDESLVTGESLP
    VQKEPGDELQGGTVVTDAPVVLEVGADATSTLDRLVSLLWSIQSARPGVQRLADKLATIFVPLVLILATGATGVLLATGS
    SISEALLVGLTVVIVSCPCALGLATPLAIASGVQSAAKRGIVVAAETIFEDAPDVDVVVLDKTGTLTTGSMTVASIQTIA
    GVDSSALHRRAAAVEALSEHPIAEAIVSDAPAGDSDDHARAAVAEFERNQRGVSGLVDGERVTVGHPDYLRDRGHELPST
    LEEVVEEARTAGDVPVAVGWDGCVQGVLVVGDAPREEWREAVNLLADGREVIVLTGDDGGAADRFREVTGVDEVFAGVPP
    AAKAETIRRLQSRGTVAMVGDGSNDAPALAAADIGIAMGSATKIATDAADAVIVSNDLAAVPDTFDLAAGTHSRIRQNLG
    WAFVYNAIAIPLALTGLLNPLFAALAMAASSALVVINSARSL