Archaeoglobus profundus DSM 5631 uid43493

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|284161144|ref|YP_003399767.1| thioredoxin [Archaeoglobus profundus DSM 5631]
    MDDIEEIRRKKLEKLAKKIRGDRMVGKPVKLDSTNFKKFIEENENVVVDFWAEWCGPCKLISPIIDELAKEYAGKVAFGK
    LNIDEDRTIAMQYGISAIPTLIFFKKGKAVSMIVGAYPKSELKRWIEKYL

    >gi|284161162|ref|YP_003399785.1| hypothetical protein Arcpr_0035 [Archaeoglobus profundus DSM 5631]
    MKKLIALLLVLTIALLGCSQKSALETGSKACNYSNIEVYFYYSPTCPHCEKVKPYIDKLREKYKDVKFIYCNVSDKNISK
    ACYTYAYYVIGVPTVVVHAGNVTTALAGDRDIIGLENLIRSLACCGK

    >gi|284161473|ref|YP_003400096.1| thioredoxin reductase [Archaeoglobus profundus DSM 5631]
    MPKLFMNYDVAIIGCGPAGLTCAIYATRYGLKTVVFEDPTNPSQLALAPQIENYPGFEGTGFELLNKMKEQAEKFGAEIK
    IEKVENVARDGELFTIKTDEGEYKAKAIVFATGSKHRKLGVEGEKEFIGRGVSY
    CAVCDGFFFKGKKVLVVGGGNTALVE
    AIYLHDLGCDVTIVHRRDEFRAEKALQDRVFEKGIKVIWNSVVERIEGKDRVERVVLRNVKMGEVFTVEVDGVFVAIGVE
    PNVELAKELGVELENGYIKVDRYQRTNVEGVFACGDCCNNPLKQVVTACGDGAIAGFSAYQFISRRKE

    >gi|284161736|ref|YP_003400359.1| pyridine nucleotide-disulphide oxidoreductase dimerization region [Archaeoglobus profundus DSM 5631]
    MDIVVIGGGACGLKAACRARRRNEEANITVVDASPYPSLGRCGLPYYIGGIVHTVDDLRKTLSGTVRDEDYFKKVKNIDV
    LTRTRAVKIDREKRIVKIVKPDGSEDELNYDYLVLATGARPIRLDIPNADADGVTTLFNPEDAEKILDMWDEGILEKAVI
    IGGGLIGMETAEALSNLDVEVTIVEIMDYILPALLDREMAMLVESYLREKGINVMTKSTVTEILTKDGRVSGVKINGTKE
    VPCDLVLMAVGVRPNVDLAVDCSLEVSKFGIKVDEYLRTSDERIFAGGDCVENKFLVTGDPIYTPMGSVANKHGRVIGDN
    ITGGSSRFPGVLGTTIFKIFDLNVARTGLTEKRARELGYDVVTCLVPGPDRAHYYPHQKPIRIKLIADRKTGRILGAQIV
    GWGVVDKRIDVVVSAMHMNATVHDLANFDLAYAPPYAPAIDTLIHAANTVRNKMDGLLETISSFELKEKLDKGEDFVILD
    IRYEDEVRKFKRIEDSRVVHIPYNELRERYKELPMDKEIVII
    CQIGNRAYDVYRFLKSKGFNCKVLDGGLAFWFW

    >gi|284161744|ref|YP_003400367.1| Peroxiredoxin [Archaeoglobus profundus DSM 5631]
    MGCPRIGDSVEFKALTTHGMIDFPKDFEGKWVVLFSHPADFTPVCTTEFVAFAKRYDKFKELNCELIGLSIDQVFSHIKW
    VEWIKEKLGVEIPFPVIADDRGQIAEKLGMIHPAKGTNTVRAVFIFDPKGVIRAILYYPQELGRNIDEILRIVRGLQVSD
    ANGVALPANWPNNELIGDKAIIPPPTDEKTAKERLEKAKAGEIECFDWWFCYKKV

    >gi|284161781|ref|YP_003400404.1| redox-active disulfide protein 2 [Archaeoglobus profundus DSM 5631]
    MKIKVVGPGCPRCKATYKIVKKVIDKEGLDAELEYVTDMNEAANLGVIATPAVWIDGEVVIQGKVPKESELLEIIKKEKK
    GEMIFYLLNKLKTRYFTPDK

    >gi|284161887|ref|YP_003400510.1| methyl-viologen-reducing hydrogenase delta subunit [Archaeoglobus profundus DSM 5631]
    MKIGVVLCTCGGTLNIDFNDVKSYVEKFVDRVEIVDFLCKNSNLDGFKGFDGIVFACCSDRSSLTFNEDRMHETARKLGI
    KFWENANIREQCAWIHDSVEATNKAKDLIAMAVEKLKLSGEYLQFKPLKKVLVIGGGVAGISCAKSLSDLGVDVTLVEEK
    PYLGGMACQIPLLWQSEGFASV
    CTSECVIPVLNREILRSNVSIFTSSRVLDVEKVDGNFRVKIEKAPQYIDPDKCVSCGK
    CSEVCPIEVPNPFDFGMTKRKAIDKDFRLAMPDTYNIVEGCNRCGECVKVCPTNAINLDAKAEIVEDEFGAIVIATGLDA
    NKDVLKKFRYDHPKVITLMEFERIMANNFFGDIPMSVVFVLCQKDEVGYCSRLCCPITVKLASRLAMTRPETEITVIYKS
    LRTYGRAFEAFRRLAESRGVEFVRADIEGIDVGEDCLIVKTSEGEFEADYVVLAEPLIPSSVMLMKKLGLKLDDFGFPLE
    FQPRVINPSESYVDRIFVVGCAKGFRDVQESIESGRAVAVKVFEALKGKEMKYYSITDIEKCSKCGLCYAVCPHNAIEFD
    EVFKIDPAFCKGCGLCYATCPSRAIKLVNLEDEQILRMADVAFKNHEGARVLAFLCYW
    CSYAAGDLMGYYGLKLPPYRSV
    RVRCSASINPDAIARILLEDKADHIIIAG
    CPPKNCHHIWGNYIEDRRIKLLKKFLKEHGLEDRVRFEYIGVAMWNKLAKI
    IKSVYSEVEESKSK

    >gi|284161940|ref|YP_003400563.1| Thioredoxin domain protein [Archaeoglobus profundus DSM 5631]
    MNSAEKLGTMEIPNGKVVIEFYSPRCKSCQDVQKILDEVLEEFEDVRLIRVNVFENREFARSFDVIALPVIIALKDGIEV
    GRLKGAKSRSEIVEFLREVFG

    >gi|284162097|ref|YP_003400720.1| Thioredoxin domain protein [Archaeoglobus profundus DSM 5631]
    MIKAIVFTSDSCPYCRIFEKIVLNELKRKFPIEFEVVNISKNPDLAEKFNIEIVPTLILVKDGKVIGGFMGFSDLKTAEA
    AIKKQLKANCYGKCP

    >gi|284162170|ref|YP_003400793.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Archaeoglobus profundus DSM 5631]
    MRVGVYICHCGFNIAGVLDIDELVEFAKSLDDVVIVRDYRFMCSNPGQELIRRDIKEYNLDRVVIAACSPNLHERTFRKV
    LSEAGLNPFFLQIANIREQCSWVHSDDSVKATEKAKRIIKSAVERVKRHRPLEIRKADVIPRVLVIGGGIAGISASLLLA
    EAGVEVYLVEREPTIGGNMAKFDKTFPTLDCAA
    CILTPKMTAVRENPNIKLFTNSEIIDVKGSVGNFKVKIRVKPRFINE
    EACTGCMECVEACLHYPMIPSEFDEKIGYRKPIHMQFPQAVPTCPYINPNECLHFLTNKCPMYCEEVCEADAIDFNQNER
    IEEIEVGAIIVATGFKLFDPSVMEEYGFGRYKNVFTALQVERMLNSTGPTGGRVVVNGREPESVAIIHCVGSRDERYKKY
    CSRVCCMYSLKLAHLIKERTNAEVYNFYMDMRTFGKGYEEFYKRILDEIRTIRGRVAEVTDVPINEDEKREVEKGKVIVV
    VEDTLLGKIVRIPVDMVILSPAMEPSEGTKELARILKVSLDENGFFKELHPKLAPTVIAPGIFVCGCAQGPKDIQDSVAQ
    AESVAGHALSMIDRGYIELEPTTAYVDEEKCSGCGICIPLCPFQAIEIDERKRAKIDELLCMGCGVCASSCPSRAIKHRL
    FESETIRAEILSLLK

    >gi|284162362|ref|YP_003400985.1| 4Fe-4S ferredoxin iron-sulfur binding domain protein [Archaeoglobus profundus DSM 5631]
    MLFCLELKRGISMNVDILVIGGGISGLTAAVEAAETGYSVALVEKNPYLGGRVTQLTKYFPKMCPPYCGLEIFLKRLKNC
    ENLQVITNAKVKKVEGVAGNFNVFVEVRPRFVNENCTACGECEKVCPVERPNDFDFGMDKTKAIYLPHDMAFPPIYVIDP
    DVCNKCGECVKVCKYDAINLDEQPQELTINAKVIIVATGWNPYDATKLETLGFGKYPNVITNMMMERLASPSGPTKGKIV
    RPSDGKEPKIVAFAQCAGSRDENHLPYCSAVCCLATMKHALYVREQIPDSKVYIFYIDRRAYGRYEDFFQKVDQDENIVF
    IRGKVAKVEEGENGNVIVHAEDTETGKKVQMEVELLVLATGMQPTTAVEKIEGLEYDDYGFVVEKEGIIPCGVARMPADV
    ASSNRDATGAVIRAIQVVRG

    >gi|284162522|ref|YP_003401145.1| methylated-DNA/protein-cysteinemethyltransferase [Archaeoglobus profundus DSM 5631]
    MIESLSVEWKVFVNVYIENGKVFKVEFSKNPVEEKFVSTTAKMLKKDLEKYFSGRRVDFRKYDVDLRVSSFVKSVLEIVK
    NIPYGKVVTYGYLARILKTSPRAIGIALKLNPVPVIIP
    CHRVVAKDGLGGFSAGVWIKRELLKLEGATFLSQQL

    >gi|284162651|ref|YP_003401274.1| 4Fe-4S ferredoxin iron-sulfur binding domain protein [Archaeoglobus profundus DSM 5631]
    MAEEEPKIGVYICHCGENIAGAVNIEEVKKFAETLPNVVVVRDYLFMCSDPGQELIKQDIKEGRVNRVVVAACTPRTHEP
    IFRKACEDAGLNKYYFEMANIRDQCSWAHWHEKEKATEKAKQIIAAAVAKARLLEPLEDRYVDITQKVLVIGGGIAGIFA
    ALDIANAGYKVYLVERNPSIGGNMAKLDKTFPTNDCSA
    CILTPLMVEVANHPNIELLTYSEVEAVEGTVGNFKVKVRKKQ
    TWVDWDLCTGCGACTDVCPPKARVPDEFNEGLSKRGAIYIQFPQAVPKKAVIDIDACIECGGRKFGTEPRKTKDGKPILA
    PCEKVCPTGAADRTKPRNPEGELIELDVGAIIVATGYKVMDKTHFKEFAPDSPNVITALQMERLISATGPTEGKLIVPSD
    IPKYEEWKKKVAKGEEVELEARKPHRIVYVSCVGSRDERFHTYCSKVCCMYMLKQAMLLKEKYPDLDIYIFFIDVRTPGK
    DFDEYYMRCRQLGIKVIKGKVGGIRRMPDERLWVRGYDAEIGKPVEVIADLVVLATAIEPSDGTIELARKLGINIGAEGF
    FRERHTKLYPVDTMTEGIFICGCAQGPKDIPDSVAQAKAAASSAMSLIAPGKMKLEPLVSEVDKEKCSGCGICVPLCPYG
    AITMTKYNESMRAEINPALCKGCGVCAAACPSKAIKLHGFTFEQVLAQVRTLAKRGIVEVL

    >gi|284162385|ref|YP_003401008.1| glutaredoxin 2 [Archaeoglobus profundus DSM 5631]
    MKLIVFTKKDCPNCPYAKKIAKEVAEELGLEFEEIDIEKDLITALQYNVASTPSIALDEEVLFRGEVPTKEELKREIEKY
    LR

    >gi|284162755|ref|YP_003401378.1| hypothetical protein Arcpr_1659 [Archaeoglobus profundus DSM 5631]
    MIVETTSEDFARLTNGKLVKSERPKTVIRNSREIVILGDVDKKKELFLKIFKKNLEDRGDIDAEVKIFIAPLCPVCPHVV
    EDICSLPIKKIEIIDVTDYPEIADEYDVMATPTVVIGKVKLVGKVSREEVLEWIKRGYDKKEYFAKLLKEGGAEDVVREV
    KKDGDASVLVDLLTYNDFMVRLGAMVAIEELAKENPEIVKKVKDKMRELLKHEDERIRQDVAMLLGDIGDESDREFLEEL
    LKEGGDVEESAREAIDEIERRNQK